General Information

General Information

DRAVP ID DRAVPe02069

Peptide Name Beta-amyloid peptide (1–40)

Sequence DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Sequence Length 40

UniProt ID A0A0A0MRG2 P05067

Taxon ID 9606

Source Homo sapiens

Validation Experimentally Validated

Origin Information

Gene Name/ID APP(351)

GenBank Y00264

Amino Acid position 672-711

Domain Accession ID pfam03494

Nucleotide sequence ID CM000683.2

Molecular Type Genomic DNA

Chromosomal Position Chromosome21:25,881,673 - 26,112,098

Activity Information

Target Organism HSV-1, IAV(H3N1,H1N1)

Assay inhibition assay

Activity

[Ref:25376108]HSV-1: Aβ 1-40 and Aβ 1-42 caused 82% and 91% decreases in HSV-1 DNA replication in MRC-5 cells.[Ref:24988208]Influenza A virus (H3N2 - Phil82): βA40 at 16 µg/mL reduced infectivity to 29±12% of control; Cal09 strain: 47±15% of control.

Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity No cytotoxicity information found in the reference(s) presented

Binding Target Not Found

Mechanism Aβ 1-40 acted directly on HSV-1 in a cell-free system and prevented viral entry into cells.The sequence homology between Aβ and a proximal transmembrane region of HSV-1 glycoprotein B suggested that Aβ interference with HSV-1 replication could involve its insertion into the HSV-1 envelope.

Structure Information

PDB ID 1AML 1AMC 1BA4

Predicted Structure Download No predicted structure available

Linear/Cyclic Linear

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Stereochemistry L

Physicochemical Information

Formula C194H295N53O58S1

Absent amino acids CPTWOU

Common amino acids GV

Mass 4329.86

Pl 5.31

Basic residues 3

Acidic residues 6

Hydrophobic residues 24

Net charge -3

Boman Index 0.98

Hydrophobicity 0.057

Aliphatic Index 90

Half Life

Mammalian:1.1 hours
Yeast:3 mins
E.coli:>10 hours

Extinction Coefficient cystines 1490

Absorbance 280nm 0.344

Polar residues 32

Literature Information

Literature 1

Title β-Amyloid peptides display protective activity against the human Alzheimer's disease-associated herpes simplex virus-1

Pubmed ID 25376108

Reference Biogerontology, 16(1), 85–98

Author Bourgade, K., Garneau, H., Giroux, G., Le Page, A. Y., Bocti, C., Dupuis, G., Frost, E. H., & Fülöp, T., Jr (2015)

DOI 10.1007/s10522-014-9538-8

Literature 2

Title Alzheimer's associated β-amyloid protein inhibits influenza A virus and modulates viral interactions with phagocytes

Pubmed ID 24988208

Reference PloS one, 9(7), e101364.

Author White, M. R., Kandel, R., Tripathi, S., Condon, D., Qi, L., Taubenberger, J., & Hartshorn, K. L. (2014).

DOI