To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe02076
Peptide Name Cecropin A
Sequence KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK
Sequence Length 37
UniProt ID P01507
Taxon ID 7123
Source Giant silk moth, Hyalophora cecropia
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position 27-63
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism HIV
Assay Transient transfection assays
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target Not Found
Mechanism cecropin is capable of inhibiting cell-associated production of HIV-1 by suppressing HIV-1 gene expression.
Structure Information
PDB ID 1D9L
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C184H312N52O47
Absent amino acids CHMSYOU
Common amino acids K
Mass 4004.82
Pl 10.39
Basic residues 8
Acidic residues 2
Hydrophobic residues 24
Net charge 6
Boman Index 0.84
Hydrophobicity -0.073
Aliphatic Index 108.11
Half Life
Extinction Coefficient cystines 5500
Absorbance 280nm 1.373
Polar residues 32
Literature Information
Literature 1
Title Antimicrobial peptides melittin and cecropin inhibit replication of human immunodeficiency virus 1 by suppressing viral gene expression
Pubmed ID 9568968
Reference The Journal of general virology, 79 ( Pt 4), 731–740.
Author Wachinger, M., Kleinschmidt, A., Winder, D., von Pechmann, N., Ludvigsen, A., Neumann, M., Holle, R., Salmons, B., Erfle, V., & Brack-Werner, R. (1998).
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.