To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe02077
Peptide Name Chicken AvBD5
Sequence GLPQDCERRGGFCSHKSCPPGIGRIGLCSKEDFCCRSRWYS
Sequence Length 41
UniProt ID Q6IV26
Taxon ID 9031
Source Gallus gallus domestic
Validation Experimentally Validated
Origin Information
Gene Name/ID GAL5
GenBank Not Available
Amino Acid position 26-66
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism IBV
Assay ELISA
Activity Not Available
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target Not Found
Mechanism Not Found
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C193H300N62O57S6
Absent amino acids ANMVOU
Common amino acids CG
Mass 4593.25
Pl 8.67
Basic residues 7
Acidic residues 4
Hydrophobic residues 24
Net charge 3
Boman Index 2.5
Hydrophobicity -0.663
Aliphatic Index 38.05
Half Life
Extinction Coefficient cystines 6990
Absorbance 280nm 1.603
Polar residues 32
Literature Information
Literature 1
Title Differential modulation of avian β-defensin and Toll-like receptor expression in chickens infected with infectious bronchitis virus
Pubmed ID 26142390
Reference Applied microbiology and biotechnology, 99(21), 9011–9024.
Author Xu, Y., Zhang, T., Xu, Q., Han, Z., Liang, S., Shao, Y., Ma, D., & Liu, S. (2015).
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.