To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe02078
Peptide Name Chicken AvBD6
Sequence SPIHACRYQRGVCIPGPCRWPYYRVGSCGSGLKSCCVRNRWA
Sequence Length 42
UniProt ID Q6QLR3
Taxon ID 9031
Source G. gallus domestic; duck, A. platyrhynchos
Validation Experimentally Validated
Origin Information
Gene Name/ID GAL6
GenBank Not Available
Amino Acid position 26-67
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism IBrV
Assay ELISA
Activity Not Available
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target Not Found
Mechanism Not Found
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C205H317N67O52S6
Absent amino acids DEFTOU
Common amino acids C
Mass 4744.55
Pl 9.61
Basic residues 7
Acidic residues 0
Hydrophobic residues 24
Net charge 7
Boman Index 1.86
Hydrophobicity -0.343
Aliphatic Index 53.33
Half Life
Extinction Coefficient cystines 15470
Absorbance 280nm 3.261
Polar residues 32
Literature Information
Literature 1
Title Differential modulation of avian β-defensin and Toll-like receptor expression in chickens infected with infectious bronchitis virus
Pubmed ID 26142390
Reference Applied microbiology and biotechnology, 99(21), 9011–9024.
Author Xu, Y., Zhang, T., Xu, Q., Han, Z., Liang, S., Shao, Y., Ma, D., & Liu, S. (2015).
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.