To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe02080
Peptide Name Cycloviolacin VY1
Sequence CGESCVFIPCITTVLGCSCSIKVCYKNGSIP
Sequence Length 31
UniProt ID None
Taxon ID None
Source Viola yedoensis
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism IAV
Assay In vitro assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target Not Found
Mechanism Not Found
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C138H226N34O42S6
Absent amino acids ARDQMWOU
Common amino acids C
Mass 3225.88
Pl 7.77
Basic residues 2
Acidic residues 1
Hydrophobic residues 18
Net charge 1
Boman Index -0.21
Hydrophobicity 0.874
Aliphatic Index 90.97
Half Life
Extinction Coefficient cystines 1490
Absorbance 280nm 0.462
Polar residues 24
Literature Information
Literature 1
Title [A cyclotide against influenza A H1N1 virus from Viola yedoensis]
Pubmed ID 25212039
Reference Yao xue xue bao = Acta pharmaceutica Sinica, 49(6), 905–912.
Author Liu, M. Z., Yang, Y., Zhang, S. X., Tang, L., Wang, H. M., Chen, C. J., Shen, Z. F., Cheng, K. D., Kong, J. Q., & Wang, W. (2014).
DOI Not Available
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.