General Information


DRAVP ID  DRAVPe02085

Peptide Name   Defensins

Sequence  ACYCRIPACIAGERRYGTCIYQGRLWAFCC

Sequence Length  30

UniProt ID  No entry found

Taxon ID  None 

Source  Synthetic construct

Validation   Experimentally Validated



Origin Information


Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available



Activity Information


Target Organism  IAV(H1N1,H3N2)

Assay  Antiviral assay.

Activity 

  • [Ref:19494312]No significant inhibition

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity  No cytotoxicity information found in the reference(s) presented

Binding Target  Membrane

Mechanism  Inhibit Virus Attachment and Virus-Cell Membrane Fusion



Structure Information


PDB ID  None

Predicted Structure Download  No predicted structure available

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C150H228N44O38S6

Absent amino acids  NDHKMSVOU

Common amino acids  ARCGIY

Mass  3448.09

Pl  8.68

Basic residues  4

Acidic residues  1

Hydrophobic residues  13

Net charge  3

Boman Index  1.1704

Hydrophobicity  0.3

Aliphatic Index  65.33

Half Life 

  •     Mammalian:4.4 hours
  •     Yeast:>20 hours
  •     E.coli:>10 hours

Extinction Coefficient cystines  10345

Absorbance 280nm  3

Polar residues  20



Literature Information


Literature 1

Title   Interactions of alpha-, beta-, and theta-defensins with influenza A virus and surfactant protein D

Pubmed ID   19494312

Reference   Journal of immunology (Baltimore, Md. : 1950), 182(12), 7878–7887.

Author   Doss, M., White, M. R., Tecle, T., Gantz, D., Crouch, E. C., Jung, G., Ruchala, P., Waring, A. J., Lehrer, R. I., & Hartshorn, K. L. (2009).

DOI   10.4049/jimmunol.0804049