To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe02086
Peptide Name PB21-37
Sequence MERIKELRDLMSWSRTREILTKTTVDHMAIIKKYTSG
Sequence Length 37
UniProt ID None
Taxon ID None
Source Synthetic construct
Validation In silico
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism IAV(H1N1,H5N1)
Assay ELISA
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target Membrane
Mechanism Inhibit Viral Replication
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification The N-terminus of PB2 consists of 3 alpha-helices, one of which binds to 3 alpha-helices in the C-terminus of PB1
Stereochemistry L
Physicochemical Information
Formula C193H326N56O57S3
Absent amino acids NCQFPOU
Common amino acids REDIKMST
Mass 4439.23
Pl 9.82
Basic residues 8
Acidic residues 5
Hydrophobic residues 13
Net charge 3
Boman Index 2.62
Hydrophobicity -0.586
Aliphatic Index 84.32
Half Life
Extinction Coefficient cystines 6990
Absorbance 280nm 1.575
Polar residues 1
Literature Information
Literature 1
Title Identification of influenza virus inhibitors which disrupt of viral polymerase protein-protein interactions
Pubmed ID 21867756
Reference Methods (San Diego, Calif.), 55(2), 188–191.
Author Chase, G., Wunderlich, K., Reuther, P., & Schwemmle, M. (2011). I
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.