DRAVP ID  DRAVPe02110

Peptide Name   Z2

Sequence  MAVLGDTAWDFGSVGGALNSLGKGIHQIFGAAF

Sequence Length  33

UniProt ID  None  

Taxon ID  None 

Source  synthetic peptide derived from the stem region of ZIKV envelope protein

Validation   Experimentally validated

Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Found

Target Organism  Zika virus (ZIKV)

Assay  plaque reduction assay 

Activity 

• [Ref:28742068]ZIKV: IC50=1.75±0.13 µM in BHK21 cells, 3.69±0.27 µM in Vero cells; plaque assay IC50=2.61±0.46 µM

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity  No cytotoxicity information found in the reference(s) presented

Binding Target  E protein

Mechanism  The mechanism by which a peptide derived from the stem region of a flavivirus can inhibit infection by a broad spectrum of flaviviruses remains a point of controversy. It was reported that DN59, a 33-mer peptide that mimics a fragment of stem region of DENV E protein, acts like a disrupter of the DENV membrane, possibly inducing hole formation, leading to release of the viral genome. Z2 peptide could bind to the E protein of ZIKV and disrupt the integrity of ZIKV membrane, resulting in the inactivation of virions

PDB ID  None

Predicted Structure Download  No predicted structure available

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L

Literature 1

Title   A peptide-based viral inactivator inhibits Zika virus infection in pregnant mice and fetuses

Pubmed ID   28742068

Reference   Nat Commun 8, 15672 (2017)

Author   Yu, Y., Deng, YQ., Zou, P. et al.

DOI   10.1038/ncomms15672