To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe02111
Peptide Name Dermaseptin-S2
Sequence ALWFTMLKKLGTMALHAGKAALGAAANTISQGTQ
Sequence Length 34
UniProt ID P80278
Taxon ID 8395
Source Sauvage's leaf frog, Phyllomedusa sauvagii, South America
Validation Experimentally validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position 1-34
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Found
Activity Information
Target Organism HSV-1
Assay Inhibition Assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target Not Found
Mechanism
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C155H255N43O43S2
Absent amino acids CDEPRVY
Common amino acids A
Mass 3473.11
Pl 10.3
Basic residues 4
Acidic residues 0
Hydrophobic residues 16
Net charge 4
Boman Index 5.06
Hydrophobicity 0.382
Aliphatic Index 92.35
Half Life
Extinction Coefficient cystines 5500
Absorbance 280nm 166.67
Polar residues 10
Literature Information
Literature 1
Title In vitro activity of dermaseptin S1 derivatives against genital pathogens
Pubmed ID 20718719
Reference acta pathologica, microbiologica, et immunologica Scandinavica, 118(9), 674–680
Author Savoia, D., Donalisio, M., Civra, A., Salvadori, S., & Guerrini, R. (2010).
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.