General Information


DRAVP ID  DRAVPe02112

Peptide Name   Anti-NN+B14:B21

Sequence  GLFPKFNKKKVKTGIFDIIKTVGKEAGMDVLRTGIDVIGCKIKGEC

Sequence Length  46

UniProt ID  No entry found

Taxon ID  None 

Source  Rana areolata

Validation   Experimentally validated



Origin Information


Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Found



Activity Information


Target Organism  HIV-1

Assay  HIV infection and cell viability assay

Activity 

  • [Ref:16140737]HIV: Inhibited infection at a concentration also toxic to T cells

Hemolytic Activity 

  • [Ref:16140737]Not hemolytic HC50=120 uM

Cytotoxicity  No cytotoxicity information found in the reference(s) presented

Binding Target  Membrane

Mechanism  Highly effective in inhibiting HIV infection by disrupting the viral membrane and preventing the entry of the virus into target cells. 



Structure Information


PDB ID  None

Predicted Structure Download  No predicted structure available

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C226H381N59O61S3

Absent amino acids  QHSWYOU

Common amino acids  K

Mass  4997.05

Pl  9.57

Basic residues  10

Acidic residues  5

Hydrophobic residues  24

Net charge  5

Boman Index  0.89

Hydrophobicity  0.03

Aliphatic Index  95.22

Half Life 

  •     Mammalian:30 hours
  •     Yeast:>20 hours
  •     E.coli:>10 hours

Extinction Coefficient cystines  0

Absorbance 280nm  0

Polar residues  32



Literature Information


Literature 1

Title   Antimicrobial peptides from amphibian skin potently inhibit human immunodeficiency virus infection and transfer of virus from dendritic cells to T cells

Pubmed ID   16140737

Reference    Journal of virology, 79(18), 11598–11606.

Author   VanCompernolle, S. E., Taylor, R. J., Oswald-Richter, K., Jiang, J., Youree, B. E., Bowie, J. H., Tyler, M. J., Conlon, J. M., Wade, D., Aiken, C., Dermody, T. S., KewalRamani, V. N., Rollins-Smith, L. A., & Unutmaz, D. (2005)

DOI   10.1128/JVI.79.18.11598-11606.2005