General Information
DRAVP ID DRAVPe02112
Peptide Name Anti-NN+B14:B21
Sequence GLFPKFNKKKVKTGIFDIIKTVGKEAGMDVLRTGIDVIGCKIKGEC
Sequence Length 46
UniProt ID No entry found
Taxon ID None
Source Rana areolata
Validation Experimentally validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Found
Activity Information
Target Organism HIV-1
Assay HIV infection and cell viability assay
Activity
Hemolytic Activity
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target Membrane
Mechanism Highly effective in inhibiting HIV infection by disrupting the viral membrane and preventing the entry of the virus into target cells.
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C226H381N59O61S3
Absent amino acids QHSWYOU
Common amino acids K
Mass 4997.05
Pl 9.57
Basic residues 10
Acidic residues 5
Hydrophobic residues 24
Net charge 5
Boman Index 0.89
Hydrophobicity 0.03
Aliphatic Index 95.22
Half Life
Extinction Coefficient cystines 0
Absorbance 280nm 0
Polar residues 32
Literature Information
Literature 1
Title Antimicrobial peptides from amphibian skin potently inhibit human immunodeficiency virus infection and transfer of virus from dendritic cells to T cells
Pubmed ID 16140737
Reference Journal of virology, 79(18), 11598–11606.
Author VanCompernolle, S. E., Taylor, R. J., Oswald-Richter, K., Jiang, J., Youree, B. E., Bowie, J. H., Tyler, M. J., Conlon, J. M., Wade, D., Aiken, C., Dermody, T. S., KewalRamani, V. N., Rollins-Smith, L. A., & Unutmaz, D. (2005)