To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe02117
Peptide Name Ginkbilobin
Sequence ANTAFVSSAHNTQKIPAGAPFNRNLRAMLADLRQNAAFAG
Sequence Length 40
UniProt ID P83171
Taxon ID 3311
Source Seeds, Ginkgo biloba, Asia
Validation Experimentally validated
Origin Information
Gene Name/ID GNK1
GenBank Not Available
Amino Acid position 1-40
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Found
Activity Information
Target Organism HIV
Assay Inhibition Assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target Not Found
Mechanism It suppressed the activity of HIV-1 reverse transcriptase
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C183H291N59O54S1
Absent amino acids CEWYOU
Common amino acids A
Mass 4213.75
Pl 11.71
Basic residues 4
Acidic residues 1
Hydrophobic residues 24
Net charge 3
Boman Index 1.62
Hydrophobicity -0.18
Aliphatic Index 71.25
Half Life
Extinction Coefficient cystines 0
Absorbance 280nm 0
Polar residues 32
Literature Information
Literature 1
Title Ginkbilobin, a novel antifungal protein from Ginkgo biloba seeds with sequence similarity to embryo-abundant protein
Pubmed ID 11118300
Reference Biochemical and biophysical research communications, 279(2), 407–411.
Author Wang, H., & Ng, T. B. (2000).
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.