To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe02123
Peptide Name Human beta defensin 1
Sequence DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
Sequence Length 36
UniProt ID P60022
Taxon ID 9606
Source Airway, hemofiltrates, urine, kidney; keratinocytes; skin; platelets; oral saliva; milk, mammary gland epithelium, colonic mucosa, H. sapiens
Validation Experimentally validated
Origin Information
Gene Name/ID DEFB1
GenBank AAC51728.1
Amino Acid position 33-68
Domain Accession ID AH006699.2
Nucleotide sequence ID CM000670.2
Molecular Type Genomic DNA
Chromosomal Position Chromosome 8: 6,870,592-6,877,936
Activity Information
Target Organism IAV(H1N1)
Assay Plaque Assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target Not Found
Mechanism β-defensin-1 plays a key role in regulating IAV survival through STAT3 and is a potential target for antiviral drug development.
Structure Information
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C167H262N48O50S6
Absent amino acids EMWOU
Common amino acids GK
Mass 3934.57
Pl 8.87
Basic residues 5
Acidic residues 1
Hydrophobic residues 24
Net charge 4
Boman Index 1.3
Hydrophobicity -0.272
Aliphatic Index 46.11
Half Life
Extinction Coefficient cystines 4470
Absorbance 280nm 1.136
Polar residues 32
Literature Information
Literature 1
Title β-Defensin-1 Regulates Influenza Virus Infection in Human Bronchial Epithelial Cells through the STAT3 Signaling Pathway
Pubmed ID 36678471
Reference Pathogens (Basel, Switzerland), 12(1), 123.
Author Othumpangat, S., & Noti, J. D. (2023).
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.