To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe02124
Peptide Name Human beta defensin 2
Sequence GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
Sequence Length 41
UniProt ID O15263,Q52LC0
Taxon ID 9606
Source Homo sapiens (Human)
Validation Experimentally validated
Origin Information
Gene Name/ID DEB4A
GenBank CAA95992.1
Amino Acid position 24-64
Domain Accession ID Z71389.1
Nucleotide sequence ID CM000670.2
Molecular Type mRNA
Chromosomal Position Chromosome 8: 7,414,855-7,416,863
Activity Information
Target Organism HIV-1
Assay Not given
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target Not Available
Mechanism Both hBD-2 and hBD-3 inhibit R5 and X4 types of HIV-1 infection in a dose-dependent manner (Sun et al. 2005 J Virol 79: 14318-29). Its anti-HIV-1 effect may be due to a direct inactivation of cell-free virions and inhibition viral replication after cDNA formation。 (1) HIV-1 X4 and R5 phenotypes induce hBD-2 and -3 mRNA in normal human oral epithelial cells; (2) hBD-2 and -3 inhibit HIV-1 infection by both viral strains, with greater activity against X4 viruses; and (3) this inhibition is due to a direct interaction with virions and through modulation of the CXCR4 co-receptor
Structure Information
PDB ID 1FD4,1FD3 resolved by X-ray. 1FQQ resolved by NMR.
Predicted Structure Download No predicted structure available
Linear/Cyclic Cyclic
N-terminal Modification Free
C-terminal Modification Free
Other Modification The 3 disulfide bonds are between residues 8-37, 15-30, and 20-38. The structure (one N-terminal helix and 3 beta strands) was found to be monomer in solution
Stereochemistry L
Physicochemical Information
Formula C188H311N55O50S6
Absent amino acids EMNW
Common amino acids CG
Mass 4334.24
Pl 9.3
Basic residues 8
Acidic residues 1
Hydrophobic residues 9
Net charge 7
Boman Index 0.9
Hydrophobicity -0.102
Aliphatic Index 64.15
Half Life
Extinction Coefficient cystines 1490
Absorbance 280nm 0.344
Polar residues 17
Literature Information
Literature 1
Title Role of Human β-defensins in HIV Infection
Pubmed ID 16672548
Reference Advances in Dental Research. 2006;19(1):42-48.
Author Weinberg A, Quiñones-Mateu ME, Lederman MM.
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.