To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe02125
Peptide Name Human beta defensin 3
Sequence GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK
Sequence Length 45
UniProt ID P81534
Taxon ID 9606
Source Skin, tonsils, oral/saliva, colonic mucosa, H. sapiens
Validation Experimentally validated
Origin Information
Gene Name/ID DEFB103A; DEFB103B
GenBank
Amino Acid position 23-67
Domain Accession ID CAC03097.1
Nucleotide sequence ID CM000670.2
Molecular Type mRNA
Chromosomal Position Chromosome 8: 7,881,392-7,882,663 forward strand.
Activity Information
Target Organism HIV-1
Assay Not Available
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target Not Found
Mechanism Both hBD-2 and hBD-3 inhibit R5 and X4 types of HIV-1 infection in a dose-dependent manner (Sun et al. 2005 J Virol 79: 14318-29). Its anti-HIV-1 effect may be due to a direct inactivation of cell-free virions and inhibition viral replication after cDNA formation。 (1) HIV-1 X4 and R5 phenotypes induce hBD-2 and -3 mRNA in normal human oral epithelial cells; (2) hBD-2 and -3 inhibit HIV-1 infection by both viral strains, with greater activity against X4 viruses; and (3) this inhibition is due to a direct interaction with virions and through modulation of the CXCR4 co-receptor
Structure Information
PDB ID 1KJ6
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C216H377N75O59S6
Absent amino acids DHMFOU
Common amino acids R
Mass 5161.2
Pl 10.08
Basic residues 13
Acidic residues 2
Hydrophobic residues 24
Net charge 11
Boman Index 2.87
Hydrophobicity -0.7
Aliphatic Index 67.11
Half Life
Extinction Coefficient cystines 2980
Absorbance 280nm 0.577
Polar residues 32
Literature Information
Literature 1
Title Role of Human β-defensins in HIV Infection
Pubmed ID 16672548
Reference Advances in Dental Research. 2006;19(1):42-48.
Author Weinberg A, Quiñones-Mateu ME, Lederman MM.
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.