General Information


DRAVP ID  DRAVPe02132

Peptide Name   HKU4-HR2P2

Sequence  EISKINTTLLDLSDEMAMLQQEVVKQLNDSYIDLKEL

Sequence Length  37

UniProt ID  No entry found

Taxon ID  None 

Source  HR2 domain of bat

Validation   Experimentally Validated



Origin Information


Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available



Activity Information


Target Organism  MERS-CoV , SARS-CoV.

Assay  Time-of-addition assay

Activity 

  • [Ref:30646495]MERS-CoV,SARS-CoV:IC50=0.38μM

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

  • [Ref: 30646495]No cytotoxicity

Binding Target  HR2 

Mechanism  HKU4-HR2 peptides could cross-target the MERS-CoV HR1 region.



Structure Information


PDB ID  None

Predicted Structure Download  No predicted structure available

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C186H311N45O65S2

Absent amino acids  RCGHFPWOU

Common amino acids  L

Mass  4281.9

Pl  4.07

Basic residues  3

Acidic residues  8

Hydrophobic residues  18

Net charge  5

Boman Index  0.9185

Hydrophobicity  -0.222

Aliphatic Index  123.78

Half Life 

  •     Mammalian:1 hour
  •     Yeast:30 min
  •     E.coli:>10 hours

Extinction Coefficient cystines  1490

Absorbance 280nm  0.348

Polar residues  22



Literature Information


Literature 1

Title   Potent MERS-CoV Fusion Inhibitory Peptides Identified from HR2 Domain in Spike Protein of Bat Coronavirus HKU4

Pubmed ID   30646495

Reference   Viruses, 11(1), 56.

Author   Xia, S., Lan, Q., Pu, J., Wang, C., Liu, Z., Xu, W., Wang, Q., Liu, H., Jiang, S., & Lu, L. (2019). 

DOI   10.3390/v11010056