To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe02132
Peptide Name HKU4-HR2P2
Sequence EISKINTTLLDLSDEMAMLQQEVVKQLNDSYIDLKEL
Sequence Length 37
UniProt ID None
Taxon ID None
Source HR2 domain of bat
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism MERS-CoV , SARS-CoV.
Assay Time-of-addition assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target HR2
Mechanism HKU4-HR2 peptides could cross-target the MERS-CoV HR1 region.
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C186H311N45O65S2
Absent amino acids RCGHFPWOU
Common amino acids L
Mass 4281.9
Pl 4.07
Basic residues 3
Acidic residues 8
Hydrophobic residues 18
Net charge 5
Boman Index 0.9185
Hydrophobicity -0.222
Aliphatic Index 123.78
Half Life
Extinction Coefficient cystines 1490
Absorbance 280nm 0.348
Polar residues 22
Literature Information
Literature 1
Title Potent MERS-CoV Fusion Inhibitory Peptides Identified from HR2 Domain in Spike Protein of Bat Coronavirus HKU4
Pubmed ID 30646495
Reference Viruses, 11(1), 56.
Author Xia, S., Lan, Q., Pu, J., Wang, C., Liu, Z., Xu, W., Wang, Q., Liu, H., Jiang, S., & Lu, L. (2019).
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.