General Information
DRAVP ID DRAVPe02134
Peptide Name HKU4-HR2P1
Sequence GENFAISKINTTLLDISDEMAMIQEVVKQLNDSYI
Sequence Length 35
UniProt ID No entry found
Taxon ID None
Source HR2 domain of bat
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism MERS-CoV
Assay Cell–Cell Fusion Assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target HR2
Mechanism These peptides target the viral fusion and entry stages.
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C172H280N42O59S2
Absent amino acids RCHPWOU
Common amino acids I
Mass 3944.48
Pl 4.02
Basic residues 2
Acidic residues 6
Hydrophobic residues 18
Net charge -4
Boman Index 0.9185
Hydrophobicity 0.02
Aliphatic Index 111.43
Half Life
Extinction Coefficient cystines 1490
Absorbance 280nm 0.378
Polar residues 22
Literature Information
Literature 1
Title Potent MERS-CoV Fusion Inhibitory Peptides Identified from HR2 Domain in Spike Protein of Bat Coronavirus HKU6
Pubmed ID 30646495
Reference Viruses, 11(1), 56.
Author Xia, S., Lan, Q., Pu, J., Wang, C., Liu, Z., Xu, W., Wang, Q., Liu, H., Jiang, S., & Lu, L. (2019).