To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe02143
Peptide Name Myticin C
Sequence QSVACRSYYCSKFCGSAGCSLYGCYLLHPGKICYCLHCSR
Sequence Length 40
UniProt ID A7DWR7
Taxon ID 29158
Source Mollusk Mytilus galloprovincialis
Validation Experimentally Validated
Origin Information
Gene Name/ID mync_MYTGA
GenBank Not Available
Amino Acid position 21-60
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism HSV-1
Assay Anti-HSV-Assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target Not found
Mechanism The intracellular phase of viral replication
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Cyclic
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C191H289N53O53S8
Absent amino acids NDEMTWOU
Common amino acids C
Mass 4432.2
Pl 8.71
Basic residues 4
Acidic residues 0
Hydrophobic residues 18
Net charge 4
Boman Index 0.9185
Hydrophobicity 0.227
Aliphatic Index 61
Half Life
Extinction Coefficient cystines 7450
Absorbance 280nm 1.681
Polar residues 12
Literature Information
Literature 1
Title Antiviral Activity of Myticin C Peptide from Mussel: an Ancient Defense against Herpesviruses
Pubmed ID 27307570
Reference Journal of virology, 90(17), 7692–7702.
Author Novoa, B., Romero, A., Álvarez, Á. L., Moreira, R., Pereiro, P., Costa, M. M., Dios, S., Estepa, A., Parra, F., & Figueras, A. (2016).
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.