General Information


DRAVP ID  DRAVPe02147

Peptide Name   MERS-HR2P

Sequence  SITQINTTLLDTTYEMISIQQVVKALNESYIDLKEL

Sequence Length  36

UniProt ID  No entry found

Taxon ID  None 

Source  HR2 domain of bat

Validation   Experimentally Validated



Origin Information


Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available



Activity Information


Target Organism  MERS-CoV

Assay  Cell–Cell Fusion Assay

Activity 

  • [Ref:30646495]SARS-CoV:IC50=1.07μM

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

  • [Ref: 30646495]No cytotoxicity

Binding Target  HR2 

Mechanism  These peptides target the viral fusion and entry stages.



Structure Information


PDB ID  None

Predicted Structure Download  No predicted structure available

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C183H303N43O62S1

Absent amino acids  RCGHFPWOU

Common amino acids  ILT

Mass  4129.73

Pl  4.18

Basic residues  2

Acidic residues  5

Hydrophobic residues  18

Net charge  -3

Boman Index  0.9185

Hydrophobicity  0.064

Aliphatic Index  127.22

Half Life 

  •     Mammalian:1.9 hours
  •     Yeast:>20 hour
  •     E.coli:>10 hours

Extinction Coefficient cystines  2980

Absorbance 280nm  0.722

Polar residues  22



Literature Information


Literature 1

Title   Inhibition of Coronavirus Entry In Vitro and Ex Vivoby a Lipid-Conjugated Peptide Derived from the SARS-CoV-2 Spike Glycoprotein HRC Domain

Pubmed ID   33082259

Reference   mBio, 11(5), e01935-20.

Author   Outlaw, V. K., Bovier, F. T., Mears, M. C., Cajimat, M. N., Zhu, Y., Lin, M. J., Addetia, A., Lieberman, N. A. P., Peddu, V., Xie, X., Shi, P. Y., Greninger, A. L., Gellman, S. H., Bente, D. A., Moscona, A., & Porotto, M. (2020).

DOI   10.1128/mBio.01935-20