To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe02147
Peptide Name MERS-HR2P
Sequence SITQINTTLLDTTYEMISIQQVVKALNESYIDLKEL
Sequence Length 36
UniProt ID None
Taxon ID None
Source HR2 domain of bat
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism MERS-CoV
Assay Cell–Cell Fusion Assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target HR2
Mechanism These peptides target the viral fusion and entry stages.
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C183H303N43O62S1
Absent amino acids RCGHFPWOU
Common amino acids ILT
Mass 4129.73
Pl 4.18
Basic residues 2
Acidic residues 5
Hydrophobic residues 18
Net charge -3
Boman Index 0.9185
Hydrophobicity 0.064
Aliphatic Index 127.22
Half Life
Extinction Coefficient cystines 2980
Absorbance 280nm 0.722
Polar residues 22
Literature Information
Literature 1
Title Inhibition of Coronavirus Entry In Vitro and Ex Vivoby a Lipid-Conjugated Peptide Derived from the SARS-CoV-2 Spike Glycoprotein HRC Domain
Pubmed ID 33082259
Reference mBio, 11(5), e01935-20.
Author Outlaw, V. K., Bovier, F. T., Mears, M. C., Cajimat, M. N., Zhu, Y., Lin, M. J., Addetia, A., Lieberman, N. A. P., Peddu, V., Xie, X., Shi, P. Y., Greninger, A. L., Gellman, S. H., Bente, D. A., Moscona, A., & Porotto, M. (2020).
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.