General Information


DRAVP ID  DRAVPe02149

Peptide Name   HKU4-HR2P3 

Sequence  LDLSDEMAMIEVVKQLNDSYIDLKELSNYTYYNKW

Sequence Length  35

UniProt ID  No entry found

Taxon ID  None 

Source  HR2 domain of bat

Validation   Experimentally Validated



Origin Information


Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available



Activity Information


Target Organism  MERS-CoV

Assay  Time-of-addition assay

Activity 

  • [Ref:30646495]SARS-CoV:IC50=0.55μM

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

  • [Ref: 30646495]No cytotoxicity

Binding Target  HR2 

Mechanism  These peptides target the viral fusion and entry stages.



Structure Information


PDB ID  None

Predicted Structure Download  No predicted structure available

Linear/Cyclic  Cyclic

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C191H291N43O62S2

Absent amino acids  RCGHFPOU

Common amino acids  L

Mass  4245.78

Pl  4.14

Basic residues  3

Acidic residues  7

Hydrophobic residues  18

Net charge  -4

Boman Index  0.91

Hydrophobicity  -0.497

Aliphatic Index  97.43

Half Life 

  •     Mammalian:5.5 hours
  •     Yeast:3 min
  •     E.coli:2 min

Extinction Coefficient cystines  11460

Absorbance 280nm  2.699

Polar residues  22



Literature Information


Literature 1

Title   Potent MERS-CoV Fusion Inhibitory Peptides Identified from HR2 Domain in Spike Protein of Bat Coronavirus HKU5

Pubmed ID   30646495

Reference   Viruses, 11(1), 56.

Author   Xia, S., Lan, Q., Pu, J., Wang, C., Liu, Z., Xu, W., Wang, Q., Liu, H., Jiang, S., & Lu, L. (2019). 

DOI   10.3390/v11010057