To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe02150
Peptide Name NP-1
Sequence GVTQNVLYENQKQIANQFNKAISQIQESLTTTSTALGKLQ
Sequence Length 40
UniProt ID P59594
Taxon ID 694009
Source HR1 region of SARS-CoV
Validation Experimentally Validated
Origin Information
Gene Name/ID S2
GenBank AAP13441.1
Amino Acid position 892-931
Domain Accession ID Not Available
Nucleotide sequence ID AY274119.3
Molecular Type Genomic RNA
Chromosomal Position Chromosome:21,492 - 25,259
Activity Information
Target Organism SARS-CoV
Assay antiviral Assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target Glycoprotein. Gp41
Mechanism like most antiviral peptides described in the literature,13 inhibi-
Structure Information
PDB ID 1WYY, 5WRG, 5X58, 5X5B, 5XLR, 5ZVM, 6ACC, 6ACD
Predicted Structure Download No predicted structure available
Linear/Cyclic Cyclic
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C191H316N54O65
Absent amino acids RDCHMPWOU
Common amino acids LN
Mass 4408.93
Pl 8.43
Basic residues 3
Acidic residues 2
Hydrophobic residues 18
Net charge 1
Boman Index 0.918
Hydrophobicity -0.497
Aliphatic Index 90.25
Half Life
Extinction Coefficient cystines 1490
Absorbance 280nm 0.338
Polar residues 22
Literature Information
Literature 1
Title Interaction between heptad repeat 1 and 2 regions in spike protein of SARS-associated coronavirus: implications for virus fusogenic mechanism and identification of fusion inhibitors
Pubmed ID 15043961
Reference Lancet (London, England), 363(9413), 938–947.
Author Liu, S., Xiao, G., Chen, Y., He, Y., Niu, J., Escalante, C. R., Xiong, H., Farmar, J., Debnath, A. K., Tien, P., & Jiang, S. (2004).
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.