To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe02159
Peptide Name 229E-HR2P
Sequence VVEQYNQTILNLTSEISTLENKSAELNYTVQKLQTLIDNINSTLVDLKWL
Sequence Length 50
UniProt ID P15423
Taxon ID 11137
Source S2 subunit of HCoV-229E
Validation Experimentally Validated
Origin Information
Gene Name/ID S2
GenBank CAA34723.1
Amino Acid position 1056-1105
Domain Accession ID Not Available
Nucleotide sequence ID AF304460.1
Molecular Type Genomic RNA
Chromosomal Position Chromosome:20,570 - 24,091
Activity Information
Target Organism SARS-CoV
Assay cell-cell fusion assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target Spike Protein
Mechanism Fusion Inhibitor
Structure Information
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C256H418N64O85
Absent amino acids RCGHMFPOU
Common amino acids L
Mass 5752.51
Pl 4.36
Basic residues 3
Acidic residues 6
Hydrophobic residues 24
Net charge -3
Boman Index 1.1
Hydrophobicity -0.156
Aliphatic Index 126.6
Half Life
Extinction Coefficient cystines 8480
Absorbance 280nm 1.474
Polar residues 32
Literature Information
Literature 1
Title Peptide-Based Membrane Fusion Inhibitors Targeting HCoV-229E Spike Protein HR1 and HR2 Domains
Pubmed ID 29415501
Reference International journal of molecular sciences, 19(2), 487.
Author Xia, S., Xu, W., Wang, Q., Wang, C., Hua, C., Li, W., Lu, L., & Jiang, S. (2018)
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.