To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe02192
Peptide Name HR2
Sequence SLSLDFEKLNVTLLDLTYEMNRIQDAIKKLNESYINLKE
Sequence Length 39
UniProt ID None
Taxon ID None
Source HR2 region of MHV
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism MHV
Assay Cell-cell fusion assay.
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target Spike Protein
Mechanism Using biological assays, the HR2 peptide was shown to be a potent inhibitor of virus entry into the cell, as well as of cell-cell fusion
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C206H337N51O66S1
Absent amino acids CGHPWOU
Common amino acids L
Mass 4616.3
Pl 4.71
Basic residues 5
Acidic residues 7
Hydrophobic residues 24
Net charge -2
Boman Index 1.1
Hydrophobicity -0.356
Aliphatic Index 120
Half Life
Extinction Coefficient cystines 2980
Absorbance 280nm 0.646
Polar residues 32
Literature Information
Literature 1
Title The coronavirus spike protein is a class I virus fusion protein: structural and functional characterization of the fusion core complex
Pubmed ID 12885899
Reference Journal of virology, 77(16), 8801–8811.
Author Bosch, B. J., van der Zee, R., de Haan, C. A., & Rottier, P. J. (2003).
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.