To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe02198
Peptide Name delta1-39-Fc
Sequence ELQREESPTGPPGSIRTWFQRIPLGWFHCTYQKGKQHCR
Sequence Length 39
UniProt ID P60172, Q7T9E0
Taxon ID 128948
Source EboV delta peptide
Validation Experimentally Validated
Origin Information
Gene Name/ID GP
GenBank AAB37097.4
Amino Acid position 325-363
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism EBOV
Assay Antiviral Assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target Glycoprotein.
Mechanism The efficacy of delta-Fc and its truncated versions (delta1-28-Fc, delta1-33-Fc, delta1-39-Fc, delta13-48-Fc, delta28-48-Fc, delta7-48-Fc, delta18-48-Fc, delta1-17-Fc) in inhibiting Ebola virus (EBOV) entry was investigated, demonstrating specific binding to filovirus-permissive cells and inhibition of EBOV glycoprotein GP1,2 entry. These Fc-tagged peptides interfere with the viral entry process, potentially preventing superinfection of producer cells and inhibiting cell transduction with filoviruses. The mechanisms of action involve binding to cell surface receptors or disrupting key viral entry steps.
Structure Information
PDB ID None
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C208H313N63O56S2
Absent amino acids ANDMVOU
Common amino acids RQGP
Mass 4656.28
Pl 9.39
Basic residues 6
Acidic residues 3
Hydrophobic residues 10
Net charge 3
Boman Index 2.58
Hydrophobicity -1.136
Aliphatic Index 40
Half Life
Extinction Coefficient cystines 12490
Absorbance 280nm 2.682
Polar residues 10
Literature Information
Literature 1
Title Ebolavirus delta-peptide immunoadhesins inhibit marburgvirus and ebolavirus cell entry
Pubmed ID 21697477
Reference J Virol. 2011;85(17):8502-13.
Author Radoshitzky SR, Warfield KL, Chi X, et al.
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.