General Information


DRAVP ID  DRAVPe02201

Peptide Name   delta7-48-Fc

Sequence  SPTGPPGSIRTWFQRIPLGWFHCTYQKGKQHCRLRIRQKVEE

Sequence Length  42

UniProt ID  P60172, Q7T9E0 

Taxon ID  128948 

Source  EboV delta peptide

Validation   Experimentally Validated



Origin Information


Gene Name/ID  GP

GenBank  AAB37097.7

Amino Acid position  331-372

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available



Activity Information


Target Organism  EBOV

Assay  Antiviral Assay

Activity 

  • [Ref:21697477]EBOV:IC50<25 nM

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity  No cytotoxicity information found in the reference(s) presented

Binding Target  Glycoprotein.

Mechanism  The efficacy of delta-Fc and its truncated versions (delta1-28-Fc, delta1-33-Fc, delta1-39-Fc, delta13-48-Fc, delta28-48-Fc, delta7-48-Fc, delta18-48-Fc, delta1-17-Fc) in inhibiting Ebola virus (EBOV) entry was investigated, demonstrating specific binding



Structure Information


PDB ID  None

Predicted Structure Download  No predicted structure available

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C226H350N70O57S2

Absent amino acids  ANDMOU

Common amino acids  R

Mass  5023.82

Pl  10.44

Basic residues  8

Acidic residues  2

Hydrophobic residues  12

Net charge  6

Boman Index  2.5

Hydrophobicity  -0.964

Aliphatic Index  53.33

Half Life 

  •     Mammalian:1.9 hours
  •     Yeast:>20 hours
  •     E.coli:>10 hours

Extinction Coefficient cystines  12490

Absorbance 280nm  2.486

Polar residues  10



Literature Information


Literature 1

Title   Ebolavirus delta-peptide immunoadhesins inhibit marburgvirus and ebolavirus cell entry

Pubmed ID   21697477

Reference   J Virol. 2011;85(17):8502-13. 

Author   Radoshitzky SR, Warfield KL, Chi X, et al.

DOI   10.1128/JVI.02600-10