General Information
DRAVP ID DRAVPe02202
Peptide Name delta18-48-Fc
Sequence WFQRIPLGWFHCTYQKGKQHCRLRIRQKVEE
Sequence Length 31
UniProt ID P60172, Q7T9E0
Taxon ID 128948
Source EboV delta peptide
Validation Experimentally Validated
Origin Information
Gene Name/ID GP
GenBank AAB37097.8
Amino Acid position 342-372
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism EBOV
Assay Antiviral Assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target Glycoprotein.
Mechanism The efficacy of delta-Fc and its truncated versions (delta1-28-Fc, delta1-33-Fc, delta1-39-Fc, delta13-48-Fc, delta28-48-Fc, delta7-48-Fc, delta18-48-Fc, delta1-17-Fc) in inhibiting Ebola virus (EBOV) entry was investigated, demonstrating specific binding
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C181H276N56O42S2
Absent amino acids ANDMVOU
Common amino acids RQ
Mass 3972.65
Pl 10.05
Basic residues 7
Acidic residues 2
Hydrophobic residues 11
Net charge 5
Boman Index 2.75
Hydrophobicity -1.029
Aliphatic Index 59.68
Half Life
Extinction Coefficient cystines 12490
Absorbance 280nm 3.144
Polar residues 6
Literature Information
Literature 1
Title Ebolavirus delta-peptide immunoadhesins inhibit marburgvirus and ebolavirus cell entry
Pubmed ID 21697477
Reference J Virol. 2011;85(17):8502-13.
Author Radoshitzky SR, Warfield KL, Chi X, et al.