General Information
DRAVP ID DRAVPe02227
Peptide Name GNCP-2
Sequence RRCICTTRTCRFPYRRLGTCLFQNRVYTFCC
Sequence Length 31
UniProt ID P49112,Q9R0Z5
Taxon ID None
Source Cavia porcellus
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism HIV-1
Assay Not Available
Activity Not Available
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target Not found
Mechanism Not Available
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Not included
N-terminal Modification Free
C-terminal Modification Free
Other Modification Three Disulfide bridges. Seq differs from GNCP-1 only at position 21 (L here and I for GNCP-1).
Stereochemistry L
Physicochemical Information
Formula C164H262N54O41S6
Absent amino acids ADEHKMSW
Common amino acids R
Mass 3838.58
Pl 9.8
Basic residues 7
Acidic residues 0
Hydrophobic residues 7
Net charge 7
Boman Index -93.39
Hydrophobicity -0.223
Aliphatic Index 47.1
Half Life
Extinction Coefficient cystines 3355
Absorbance 280nm 111.83
Polar residues 15
Literature Information
Literature 1
Title Cloning and characterization of the guinea pig neutrophil cationic peptide-1 and -2 genes.
Pubmed ID 8173076
Reference DNA Seq. 1993;4(2):123-128
Author Nagaoka I, Nonoguchi A, Yamashita T.