General Information


DRAVP ID  DRAVPe02227

Peptide Name   GNCP-2

Sequence  RRCICTTRTCRFPYRRLGTCLFQNRVYTFCC

Sequence Length  31

UniProt ID  P49112,Q9R0Z5 

Taxon ID  None

Source  Cavia porcellus

Validation   Experimentally Validated



Origin Information


Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available



Activity Information


Target Organism  HIV-1

Assay  Not Available

Activity  Not Available

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity  No cytotoxicity information found in the reference(s) presented

Binding Target  Not found

Mechanism  Not Available



Structure Information


PDB ID  None

Predicted Structure Download  No predicted structure available

Linear/Cyclic  Not included

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  Three Disulfide bridges. Seq differs from GNCP-1 only at position 21 (L here and I for GNCP-1).

Stereochemistry  L



Physicochemical Information


Formula  C164H262N54O41S6

Absent amino acids  ADEHKMSW

Common amino acids  R

Mass  3838.58

Pl  9.8

Basic residues  7

Acidic residues  0

Hydrophobic residues  7

Net charge  7

Boman Index  -93.39

Hydrophobicity  -0.223

Aliphatic Index  47.1

Half Life 

  •     Mammalian:1 hour
  •     Yeast:2 min
  •     E.coli:2 min

Extinction Coefficient cystines  3355

Absorbance 280nm  111.83

Polar residues  15



Literature Information


Literature 1

Title   Cloning and characterization of the guinea pig neutrophil cationic peptide-1 and -2 genes.

Pubmed ID   8173076

Reference   DNA Seq. 1993;4(2):123-128

Author   Nagaoka I, Nonoguchi A, Yamashita T.

DOI