To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe02233
Peptide Name P155–185-Chol
Sequence GTYDHDVYRDEALNNRFQIKGVELKSGYKDWGSGSGC
Sequence Length 37
UniProt ID No entry found
Taxon ID None
Source Synthetic construct
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism Influenza A H3N2
Assay Plaque reduction
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target Hemagglutinin protein
Mechanism The complete sequence (155–185) corresponds to the HA2 portion that bundles to the inner coiled-coil that is crucial for the fusion process; compound P155–181 lacks the four final residues between the N-capped coiled-coil and the transmembrane domain, while compound P155–175 corresponds to the most truncated sequence deficient the N-cap motif. Only cholesterol-tagged compounds containing the N-cap motif (155–185-Chol and 155–181-Chol) demonstrated antiviral activity against IAV/H3N2 in cell culture, most likely due to the ability of the cholesterol to fasten the peptide to the membrane and to form nanoparticles
Structure Information
PDB ID None
Linear/Cyclic Linear
N-terminal Modification Not included yet
C-terminal Modification Not included yet
Other Modification (PEG4-Chol)NH2, (155–185-Chol and 155–181-Chol)
Stereochemistry L
Physicochemical Information
Formula C181H270N52O60S1
Absent amino acids MPOU
Common amino acids G
Mass 4166.51
Pl 5.55
Basic residues 5
Acidic residues 6
Hydrophobic residues 9
Net charge -1
Boman Index 2.56
Hydrophobicity -1.03
Aliphatic Index 50
Half Life
Extinction Coefficient cystines 9970
Absorbance 280nm 2.393
Polar residues 10
Literature Information
Literature 1
Title Capturing a fusion intermediate of influenza hemagglutinin with a cholesterol-conjugated peptide, a new antiviral strategy for influenza virus
Pubmed ID 21994935
Reference The Journal of biological chemistry, 286(49), 42141–42149.
Author Lee, K. K., Pessi, A., Gui, L., Santoprete, A., Talekar, A., Moscona, A., & Porotto, M. (2011).
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.