To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe02256
Peptide Name H-HR2
Sequence RARRSLLIASALCTSDVAAATNADLRTALARADHQKTLFWL
Sequence Length 41
UniProt ID No entry found
Taxon ID None
Source Synthetic construct
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism HSV-1
Assay Virus entry assays.
Activity
Hemolytic Activity
Cytotoxicity
Binding Target Fusion machinery
Mechanism H-HR2 and B-HR1 also inhibit this step, but their effects are less pronounced compared to H-HR1.
Structure Information
PDB ID None
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C194H324N62O57S1
Absent amino acids EGMYOU
Common amino acids A
Mass 4469.15
Pl 10.64
Basic residues 6
Acidic residues 3
Hydrophobic residues 22
Net charge 3
Boman Index 1.84
Hydrophobicity 0.132
Aliphatic Index 107.56
Half Life
Extinction Coefficient cystines 5500
Absorbance 280nm 1.231
Polar residues 9
Literature Information
Literature 1
Title Analysis of synthetic peptides from heptad-repeat domains of herpes simplex virus type 1 glycoproteins H and B.
Pubmed ID 16603508
Reference The Journal of general virology, 87(Pt 5), 1085–1097.
Author Galdiero, S., Vitiello, M., D'Isanto, M., Falanga, A., Collins, C., Raieta, K., Pedone, C., Browne, H., & Galdiero, M. (2006).
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.