General Information
DRAVP ID DRAVPe02277
Peptide Name mBD-1
Sequence DQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS
Sequence Length 37
UniProt ID P56386
Taxon ID 10090
Source Mus musculus
Validation Experimentally Validated
Origin Information
Gene Name/ID Defb1
GenBank AA071757
Amino Acid position 33-69
Domain Accession ID Not Available
Nucleotide sequence ID CM001001.3
Molecular Type mRNA
Chromosomal Position Chromosome 8: 22,266,615-22,285,201
Activity Information
Target Organism IAV
Assay Cell transfection Assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target Membrane
Mechanism mBD1-mBD3 expressed by the recombinant plasmid pcDNA3.1(+)/mBD1-mBD3 could inhibit influenza A virus replication both in vitro and in vivo.
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C168H272N52O54S6
Absent amino acids AEIMOUVW
Common amino acids C
Mass 4076.68
Pl 8.89
Basic residues 6
Acidic residues 2
Hydrophobic residues 4
Net charge 4
Boman Index 2.3
Hydrophobicity -0.93
Aliphatic Index 31.62
Half Life
Extinction Coefficient cystines 1865
Absorbance 280nm 0.457
Polar residues 27
Literature Information
Literature 1
Title Construction of eukaryotic expression vector with mBD1-mBD3 fusion genes and exploring its activity against influenza A virus
Pubmed ID 24632574
Reference Viruses, 6(3), 1237–1252.
Author Li, W., Feng, Y., Kuang, Y., Zeng, W., Yang, Y., Li, H., Jiang, Z., & Li, M. (2014).
DOI 10.3390/v6031237