To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe02278
Peptide Name MBD-3
Sequence KINNPVSCLRKGGRCWNRCIGNTRQIGSCGVPFLKCCKRK
Sequence Length 40
UniProt ID Q9WTL0
Taxon ID 10090
Source Epithelia, respiratory system and other mucosal surfaces, mouse, M. musculus
Validation Experimentally Validated
Origin Information
Gene Name/ID Defb3
GenBank AA065510##AJ011800## AF092929
Amino Acid position 24-63
Domain Accession ID Not Available
Nucleotide sequence ID CM001001.3
Molecular Type Genomic DNA
Chromosomal Position Chromosome 8: 19,343,376-19,345,307 forward strand.
Activity Information
Target Organism IAV
Assay Cell transfection Assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target Membrane
Mechanism mBD1-mBD3 expressed by the recombinant plasmid pcDNA3.1(+)/mBD1-mBD3 could inhibit influenza A virus replication both in vitro and in vivo.
Structure Information
PDB ID None
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C189H322N66O49S6
Absent amino acids ADEHMOUY
Common amino acids C
Mass 4495.41
Pl 10.26
Basic residues 10
Acidic residues 0
Hydrophobic residues 9
Net charge 10
Boman Index 2.33
Hydrophobicity -0.515
Aliphatic Index 63.25
Half Life
Extinction Coefficient cystines 5875
Absorbance 280nm 1.307
Polar residues 24
Literature Information
Literature 1
Title Antiviral activity of recombinant mouse β-defensin 3 against influenza A virus in vitro and in vivo
Pubmed ID 22345365
Reference Antiviral chemistry & chemotherapy, 22(6), 255–262
Author Jiang, Y., Yang, D., Li, W., Wang, B., Jiang, Z., & Li, M. (2012)
DOI 10.3851/IMP2077
Literature 2
Title Expression of mouse beta-defensin-3 in MDCK cells and its anti-influenza-virus activity
Pubmed ID 19301094
Reference Archives of virology, 154(4), 639–647
Author Jiang, Y., Wang, Y., Kuang, Y., Wang, B., Li, W., Gong, T., Jiang, Z., Yang, D., & Li, M. (2009)
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.