To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe02279
Peptide Name mCRAMP
Sequence GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
Sequence Length 34
UniProt ID A0A8C6H0U3
Taxon ID 10103
Source Adult testis, spleen, stomach, and intestine, Mice, M. musculus
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Found
GenBank Not Found
Amino Acid position 140-173
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Found
Chromosomal Position Primary_assembly QGOO01036336.1: 6,325-8,294 forward strand.
Activity Information
Target Organism RSV,ZIKV
Assay Antiviral Assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target Not Found
Mechanism CRAMP can combat ZIKV outside cells, and consequently inhibit viral attachment and entry.Cathelicidin CRAMP significantly inhibited the attachment and entry of ZIKV in Vero cells
Structure Information
PDB ID None
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C178H302N50O46
Absent amino acids ACDHMOSTUWY
Common amino acids K
Mass 3878.66
Pl 10.22
Basic residues 9
Acidic residues 3
Hydrophobic residues 10
Net charge 6
Boman Index 1.74
Hydrophobicity -0.894
Aliphatic Index 88.82
Half Life
Extinction Coefficient cystines 0
Absorbance 280nm 0
Polar residues 17
Literature Information
Literature 1
Title Cathelicidins Have Direct Antiviral Activity against Respiratory Syncytial Virus In Vitro and Protective Function In Vivo in Mice and Humans
Pubmed ID 26873992
Reference Journal of immunology (Baltimore, Md. : 1950), 196(6), 2699–2710
Author Currie, S. M., Gwyer Findlay, E., McFarlane, A. J., Fitch, P. M., Böttcher, B., Colegrave, N., Paras, A., Jozwik, A., Chiu, C., Schwarze, J., & Davidson, D. J. (2016)
Literature 2
Title Endogenous cathelicidin is required for protection against ZIKV-caused testis damage via inactivating virons
Pubmed ID 35038500
Reference Antiviral research, 198, 105248.
Author Liu, Z., Wu, J., Qin, Z., Dong, C., Yang, H., Sun, J., Xu, W., & Wei, L. (2022)
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.