General Information


DRAVP ID  DRAVPe02286

Peptide Name   Myticin C

Sequence  QEAQSVACTSYYCSKFCGSAGCSLYGCYLLHPGKICYCLHCSR

Sequence Length  43

UniProt ID  A7DWS7 

Taxon ID  29158 

Source  The mediterranean mussel, Mytilus galloprovincialis

Validation   Experimentally Validated



Origin Information


Gene Name/ID  mync_MYTGA

GenBank  Not Available

Amino Acid position  18-60

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available



Activity Information


Target Organism  HSV-1,HSV-2,VHSV

Assay   Viral Infectivity Assays

Activity 

  • [Ref:21858010]VHSV:The results showed ≥85% reduced VHSV infectivity in CHSE cells transfected with Myt C.[Ref:23880927]VHSV:Maximal inhibition of viral infectivity (40%) was observed when 125 μM of red-MytCc were pre-incubated with VHSV.[Ref:27307570]The viral titer in infected oyster hemocytes treated with synthetic myticin decreased by 99.95% at 24 h. HSV-1:EC50=5.85 ± 1.24 μM (25.98 ± 5.49 μg/ml),HSV-2:EC50 =5.41 ± 0.95 μM (24.03 ± 4.21 μg/ml),

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

  • [Ref:23880927]No cytotoxicity was observed when the Epithelioma Papulosum Cyprini (EPC) cell monolayers were treated with synthetic red-MytCc at concentrations up to 125 μM during 72 h, indicating tha

Binding Target  Not Found

Mechanism  CHSE cells expressing Myt C had reduced susceptibility to VHSV.viral replication could not be detected in the cells expressing the Myt C variants but was detected in the surrounding non-expressing cells.very low levels of VHSV replication could be detected in the CHSE Myt C-expressing cells compared with the eGFP-transfected or non-transfected cells, suggesting the induction of some protective effect on the surrounding cells by the expression of Myt C, which could act as a cytokine-like molecule.



Structure Information


PDB ID  None

Predicted Structure Download  No predicted structure available

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C202H304N54O60S8

Absent amino acids  DMNOUW

Common amino acids  C

Mass  4705.44

Pl  8.19

Basic residues  7

Acidic residues  4

Hydrophobic residues  10

Net charge  3

Boman Index  0.6

Hydrophobicity  0.179

Aliphatic Index  59.07

Half Life 

  •     Mammalian:0.8hours
  •     Yeast:10min
  •     E.coli:10hours

Extinction Coefficient cystines  7950

Absorbance 280nm  1.69

Polar residues  28



Literature Information


Literature 1

Title   Mytilus galloprovincialis myticin C: a chemotactic molecule with antiviral activity and immunoregulatory properties

Pubmed ID   21858010

Reference   PloS one, 6(8), e23140

Author   Balseiro, P., Falcó, A., Romero, A., Dios, S., Martínez-López, A., Figueras, A., Estepa, A., & Novoa, B. (2011)

DOI   10.1371/journal.pone.0023140

Literature 2

Title   pH-dependent solution structure and activity of a reduced form of the host-defense peptide myticin C (Myt C) from the mussel Mytilus galloprovincialis

Pubmed ID   23880927

Reference   Marine drugs, 11(7), 2328–2346

Author   Martinez-Lopez, A., Encinar, J. A., Medina-Gali, R. M., Balseiro, P., Garcia-Valtanen, P., Figueras, A., Novoa, B., & Estepa, A. (2013)

DOI   10.3390/md11072328

Literature 3

Title   Antiviral Activity of Myticin C Peptide from Mussel: an Ancient Defense against Herpesviruses

Pubmed ID   27307570

Reference   journal of virology, 90(17), 7692–7702.

Author   Novoa, B., Romero, A., Álvarez, Á. L., Moreira, R., Pereiro, P., Costa, M. M., Dios, S., Estepa, A., Parra, F., & Figueras, A. (2016).

DOI   10.1128/JVI.00591-16