DRAVP ID  DRAVPe02289

Peptide Name   Palustrin-3AR

Sequence  GIFPKIIGKGIVNGIKSLAKGVGMKVFKAGLNNIGNTGCNNRDEC

Sequence Length  45

UniProt ID  No entry found

Taxon ID  None

Source  the crawfish frog, Rana areolata, North America

Validation   Experimentally Validated

Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available

Target Organism  HIV-1

Assay  Anti-HIV activity Assay

Activity 

• [Ref:16140737]HIV-1:This peptide could inhibit HIV infection at a concentration that is also toxic to T cells

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

• [Ref:16140737]Non Cytotoxic

Binding Target  Not Found

Mechanism  Not Available

PDB ID  None

Predicted Structure Download 

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L

Literature 1

Title   Antimicrobial peptides from amphibian skin potently inhibit human immunodeficiency virus infection and transfer of virus from dendritic cells to T cells

Pubmed ID   16140737

Reference    Journal of virology, 79(18), 11598–11606.

Author   VanCompernolle, S. E., Taylor, R. J., Oswald-Richter, K., Jiang, J., Youree, B. E., Bowie, J. H., Tyler, M. J., Conlon, J. M., Wade, D., Aiken, C., Dermody, T. S., KewalRamani, V. N., Rollins-Smith, L. A., & Unutmaz, D. (2005)

DOI   10.1128/JVI.79.18.11598-11606.2005