General Information


DRAVP ID  DRAVPe02289

Peptide Name   Palustrin-3AR

Sequence  GIFPKIIGKGIVNGIKSLAKGVGMKVFKAGLNNIGNTGCNNRDEC

Sequence Length  45

UniProt ID  No entry found

Taxon ID  None

Source  the crawfish frog, Rana areolata, North America

Validation   Experimentally Validated



Origin Information


Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available



Activity Information


Target Organism  HIV-1

Assay  Anti-HIV activity Assay

Activity 

  • [Ref:16140737]HIV-1:This peptide could inhibit HIV infection at a concentration that is also toxic to T cells

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

  • [Ref:16140737]Non Cytotoxic

Binding Target  Not Found

Mechanism  Not Available



Structure Information


PDB ID  None

Predicted Structure Download  No predicted structure available

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C203H342N60O58S3

Absent amino acids  HOQUWY

Common amino acids  G

Mass  4647.5

Pl  9.79

Basic residues  7

Acidic residues  2

Hydrophobic residues  16

Net charge  5

Boman Index  0.78

Hydrophobicity  0.016

Aliphatic Index  93.11

Half Life 

  •     Mammalian:30hours
  •     Yeast:>20hours
  •     E.coli:>10hours

Extinction Coefficient cystines  125

Absorbance 280nm  0.027

Polar residues  19



Literature Information


Literature 1

Title   Antimicrobial peptides from amphibian skin potently inhibit human immunodeficiency virus infection and transfer of virus from dendritic cells to T cells

Pubmed ID   16140737

Reference    Journal of virology, 79(18), 11598–11606.

Author   VanCompernolle, S. E., Taylor, R. J., Oswald-Richter, K., Jiang, J., Youree, B. E., Bowie, J. H., Tyler, M. J., Conlon, J. M., Wade, D., Aiken, C., Dermody, T. S., KewalRamani, V. N., Rollins-Smith, L. A., & Unutmaz, D. (2005)

DOI   10.1128/JVI.79.18.11598-11606.2005