General Information
DRAVP ID DRAVPe02289
Peptide Name Palustrin-3AR
Sequence GIFPKIIGKGIVNGIKSLAKGVGMKVFKAGLNNIGNTGCNNRDEC
Sequence Length 45
UniProt ID No entry found
Taxon ID None
Source the crawfish frog, Rana areolata, North America
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism HIV-1
Assay Anti-HIV activity Assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target Not Found
Mechanism Not Available
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C203H342N60O58S3
Absent amino acids HOQUWY
Common amino acids G
Mass 4647.5
Pl 9.79
Basic residues 7
Acidic residues 2
Hydrophobic residues 16
Net charge 5
Boman Index 0.78
Hydrophobicity 0.016
Aliphatic Index 93.11
Half Life
Extinction Coefficient cystines 125
Absorbance 280nm 0.027
Polar residues 19
Literature Information
Literature 1
Title Antimicrobial peptides from amphibian skin potently inhibit human immunodeficiency virus infection and transfer of virus from dendritic cells to T cells
Pubmed ID 16140737
Reference Journal of virology, 79(18), 11598–11606.
Author VanCompernolle, S. E., Taylor, R. J., Oswald-Richter, K., Jiang, J., Youree, B. E., Bowie, J. H., Tyler, M. J., Conlon, J. M., Wade, D., Aiken, C., Dermody, T. S., KewalRamani, V. N., Rollins-Smith, L. A., & Unutmaz, D. (2005)