General Information

General Information

DRAVP ID DRAVPe02290

Peptide Name Plantaricin NC8 α

Sequence LTTKLWSSWGYYLGKKARWNLKHPYVQF

Sequence Length 28

UniProt ID I6TUU6

Taxon ID 337330

Source Lactiplantibacillus plantarum; Lactobacillus plantarum NC8

Validation Experimentally Validated

Origin Information

Gene Name/ID plnc8A

GenBank Not Available

Amino Acid position 20-47

Domain Accession ID Not Available

Nucleotide sequence ID Not Available

Molecular Type Not Available

Chromosomal Position Not Available

Activity Information

Target Organism LGTV,IAV,HIV-1.SARS-CoV-2

Assay Virus Inhibition assays

Activity

[Ref:36449554]KUNV:A final peptide concentration of 1 μM reduced the viral load by >50%, while concentrations of ≥10 μM completely eliminated all virions.L-PLNC8 αβ or D-PLNC8 αβ caused more than 99.9% reduction in the titer of infective KUNV,WNV:The virus particles are rapidly permeabilized by both enantiomers of PLNC8 αβ that decreased the viral load by >99.9% of WNV.A 50% reduction of PFU with the L- and D-form of PLNC8 αβ was achieved at 0.001 μM.SARS-CoV-2:A 50% reduction of PFU with the L- and D-form of PLNC8 αβ was achieved at 0.001 μM. PLNC8 β (L- and D-form) alone required ~0.5 μM to cause a 50% reduction of the viral load at the same SARS-CoV-2 virus concentration.IAV: reduced IAV by 50% at ~0.5 μM.HIV-1:50% reduction concentration was ~20 μM

Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity

[Ref:36449554]Non Cytotoxic in Vero Cells and to human cells.

Binding Target Membrane

Mechanism it mainly targets the lipid compartment of virus envelopes, which is more or less stable since it is derived from membranes of infected host cells.

Structure Information

PDB ID None

Predicted Structure Download

Linear/Cyclic Linear

N-terminal Modification Free

C-terminal Modification Free

Other Modification A two-chain bacteriocin which requires chain B for optimal activity. The sequence of chain B is SVPTSVYTLGIKILWSAYKHRKTIEKSFNKGFYH

Stereochemistry L

Physicochemical Information

Formula C169H244N42O38

Absent amino acids CDEIMOU

Common amino acids KL

Mass 3472.06

Pl 10.12

Basic residues 5

Acidic residues 0

Hydrophobic residues 10

Net charge 5

Boman Index 1.03

Hydrophobicity -0.654

Aliphatic Index 69.64

Half Life

Mammalian:5.5hours
Yeast:3min
E.coli:2min

Extinction Coefficient cystines 20970

Absorbance 280nm 6.04

Polar residues 15

Literature Information

Literature 1

Title Plantaricin NC8 αβ rapidly and efficiently inhibits flaviviruses and SARS-CoV-2 by disrupting their envelopes

Pubmed ID 36449554

Reference PloS one, 17(11), e0278419.

Author Omer, A. A. M., Hinkula, J., Tran, P. T., Melik, W., Zattarin, E., Aili, D., Selegård, R., Bengtsson, T., & Khalaf, H. (2022).

DOI 10.1371/journal.pone.0278419