General Information
DRAVP ID DRAVPe02290
Peptide Name Plantaricin NC8 α
Sequence LTTKLWSSWGYYLGKKARWNLKHPYVQF
Sequence Length 28
UniProt ID I6TUU6
Taxon ID 337330
Source Lactiplantibacillus plantarum; Lactobacillus plantarum NC8
Validation Experimentally Validated
Origin Information
Gene Name/ID plnc8A
GenBank Not Available
Amino Acid position 20-47
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism LGTV,IAV,HIV-1.SARS-CoV-2
Assay Virus Inhibition assays
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target Membrane
Mechanism it mainly targets the lipid compartment of virus envelopes, which is more or less stable since it is derived from membranes of infected host cells.
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification A two-chain bacteriocin which requires chain B for optimal activity. The sequence of chain B is SVPTSVYTLGIKILWSAYKHRKTIEKSFNKGFYH
Stereochemistry L
Physicochemical Information
Formula C169H244N42O38
Absent amino acids CDEIMOU
Common amino acids KL
Mass 3472.06
Pl 10.12
Basic residues 5
Acidic residues 0
Hydrophobic residues 10
Net charge 5
Boman Index 1.03
Hydrophobicity -0.654
Aliphatic Index 69.64
Half Life
Extinction Coefficient cystines 20970
Absorbance 280nm 6.04
Polar residues 15
Literature Information
Literature 1
Title Plantaricin NC8 αβ rapidly and efficiently inhibits flaviviruses and SARS-CoV-2 by disrupting their envelopes
Pubmed ID 36449554
Reference PloS one, 17(11), e0278419.
Author Omer, A. A. M., Hinkula, J., Tran, P. T., Melik, W., Zattarin, E., Aili, D., Selegård, R., Bengtsson, T., & Khalaf, H. (2022).