General Information


DRAVP ID  DRAVPe02290

Peptide Name   Plantaricin NC8 α

Sequence  LTTKLWSSWGYYLGKKARWNLKHPYVQF

Sequence Length  28

UniProt ID  I6TUU6 

Taxon ID  337330 

Source  Lactiplantibacillus plantarum; Lactobacillus plantarum NC8

Validation   Experimentally Validated



Origin Information


Gene Name/ID  plnc8A

GenBank  Not Available

Amino Acid position  20-47

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available



Activity Information


Target Organism  LGTV,IAV,HIV-1.SARS-CoV-2

Assay  Virus Inhibition assays

Activity 

  • [Ref:36449554]KUNV:A final peptide concentration of 1 μM reduced the viral load by >50%, while concentrations of ≥10 μM completely eliminated all virions.L-PLNC8 αβ or D-PLNC8 αβ caused more than 99.9% reduction in the titer of infective KUNV,WNV:The virus particles are rapidly permeabilized by both enantiomers of PLNC8 αβ that decreased the viral load by >99.9% of WNV.A 50% reduction of PFU with the L- and D-form of PLNC8 αβ was achieved at 0.001 μM.SARS-CoV-2:A 50% reduction of PFU with the L- and D-form of PLNC8 αβ was achieved at 0.001 μM. PLNC8 β (L- and D-form) alone required ~0.5 μM to cause a 50% reduction of the viral load at the same SARS-CoV-2 virus concentration.IAV: reduced IAV by 50% at ~0.5 μM.HIV-1:50% reduction concentration was ~20 μM

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

  • [Ref:36449554]Non Cytotoxic in Vero Cells and to human cells.

Binding Target  Membrane

Mechanism  it mainly targets the lipid compartment of virus envelopes, which is more or less stable since it is derived from membranes of infected host cells.



Structure Information


PDB ID  None

Predicted Structure Download  No predicted structure available

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  A two-chain bacteriocin which requires chain B for optimal activity. The sequence of chain B is SVPTSVYTLGIKILWSAYKHRKTIEKSFNKGFYH

Stereochemistry  L



Physicochemical Information


Formula  C169H244N42O38

Absent amino acids  CDEIMOU

Common amino acids  KL

Mass  3472.06

Pl  10.12

Basic residues  5

Acidic residues  0

Hydrophobic residues  10

Net charge  5

Boman Index  1.03

Hydrophobicity  -0.654

Aliphatic Index  69.64

Half Life 

  •     Mammalian:5.5hours
  •     Yeast:3min
  •     E.coli:2min

Extinction Coefficient cystines  20970

Absorbance 280nm  6.04

Polar residues  15



Literature Information


Literature 1

Title   Plantaricin NC8 αβ rapidly and efficiently inhibits flaviviruses and SARS-CoV-2 by disrupting their envelopes

Pubmed ID   36449554

Reference   PloS one, 17(11), e0278419.

Author   Omer, A. A. M., Hinkula, J., Tran, P. T., Melik, W., Zattarin, E., Aili, D., Selegård, R., Bengtsson, T., & Khalaf, H. (2022).

DOI   10.1371/journal.pone.0278419