General Information
DRAVP ID DRAVPe02291
Peptide Name 1-Chol
Sequence KKKKGSGIEPHDWTKNITDKIDQIIHDFVDK
Sequence Length 32
UniProt ID No entry found
Taxon ID None
Source Synthetic construct
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism EBOV
Assay Antiviral Assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target Glycoprotein.
Mechanism 1-Chol, a cholesterol-conjugated C-peptide inhibitor, disrupts Ebola virus cell entry by targeting the glycoprotein-mediated fusion process. Specifically, it binds to the GP2 C-heptad repeat region (CHR), hindering the formation of the six-helix bundle crucial for membrane fusion. Effective at a concentration of 40 microM, 1-Chol's cholesterol conjugation enhances its alpha-helical structure independently of concentration, contributing to its broad inhibitory activity against Ebola virus. The combined peptide and cholesterol components of 1-Chol play a vital role in its inhibition of viral entry
Structure Information
PDB ID None
Linear/Cyclic Linear
N-terminal Modification cholesterylation
C-terminal Modification Free
Other Modification In the peptide sequence, the cysteine residue at position 1 is modified with a cholesterol (Chol) moiety. This HIV-1 C-peptide conjugated to cholesterol contain covalent side chain-side chain crosslinks to promote an alpha-helical conformation. The cholesterol-conjugated C-peptides proved to be potent inhibitors of Ebola virus glycoprotein (GP)-mediated cell entry (~10^3-fold reduction in infection at 40 microM)
Stereochemistry L
Physicochemical Information
Formula C163H261N45O49
Absent amino acids ACLMORUY
Common amino acids K
Mass 3635.14
Pl 8.32
Basic residues 7
Acidic residues 6
Hydrophobic residues 8
Net charge 1
Boman Index 2.69
Hydrophobicity -1.216
Aliphatic Index 72.26
Half Life
Extinction Coefficient cystines 5500
Absorbance 280nm 1.513
Polar residues 20
Literature Information
Literature 1
Title C-peptide inhibitors of Ebola virus glycoprotein-mediated cell entry: effects of conjugation to cholesterol and side chain-side chain crosslinking.
Pubmed ID 23962564
Reference Bioorg Med Chem Lett. 2013;23(19):5356-60.
Author  Higgins CD, Koellhoffer JF, Chandran K