DRAVP ID  DRAVPe02306

Peptide Name   TEWP

Sequence  QKKCPGRCTLKCGKHERPTLPYNCGKYICCVPVKVK

Sequence Length  36

UniProt ID  P0CAP0 

Taxon ID  8467 

Source  Red sea turtle Caretta caretta

Validation   Experimentally Validated

Gene Name/ID  TEWP

GenBank  Not Available

Amino Acid position  1-36

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available

Target Organism  CHAV

Assay  Viral Inhibition Assays

Activity 

• [Ref:16700051]CHAV:IC50=10^5mM.Viral infection leads to shrinkage of cell volume by about 80% and addition of TEWP leads to recovery of the cell volume

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity  No cytotoxicity information found in the reference(s) presented

Binding Target  Not Found

Mechanism  Antiviral action may occur because of inhibition of viral replication and/or transcription

PDB ID  None

Predicted Structure Download 

Linear/Cyclic  Linear

N-terminal Modification  Pyroglutamatation

C-terminal Modification  Carboxylation

Other Modification  The N-terminal Q is pyroglutamate. There are three disulfide bonds: C1-C6; C2-C5; C3-C4, different from those of the vertebrate beta-defensins.

Stereochemistry  L

Literature 1

Title   Small cationic protein from a marine turtle has beta-defensin-like fold and antibacterial and antiviral activity

Pubmed ID   16700051

Reference   Proteins, 64(2), 524–531.

Author   Chattopadhyay, S., Sinha, N. K., Banerjee, S., Roy, D., Chattopadhyay, D., & Roy, S. (2006).

DOI   10.1002/prot.20963