General Information
DRAVP ID DRAVPe02306
Peptide Name TEWP
Sequence QKKCPGRCTLKCGKHERPTLPYNCGKYICCVPVKVK
Sequence Length 36
UniProt ID P0CAP0
Taxon ID 8467
Source Red sea turtle Caretta caretta
Validation Experimentally Validated
Origin Information
Gene Name/ID TEWP
GenBank Not Available
Amino Acid position 1-36
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism CHAV
Assay Viral Inhibition Assays
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target Not Found
Mechanism Antiviral action may occur because of inhibition of viral replication and/or transcription
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Pyroglutamatation
C-terminal Modification Carboxylation
Other Modification The N-terminal Q is pyroglutamate. There are three disulfide bonds: C1-C6; C2-C5; C3-C4, different from those of the vertebrate beta-defensins.
Stereochemistry L
Physicochemical Information
Formula C177H297N53O45S6
Absent amino acids ADFMOSUW
Common amino acids K
Mass 4079.99
Pl 9.54
Basic residues 9
Acidic residues 1
Hydrophobic residues 6
Net charge 8
Boman Index 1.67
Hydrophobicity -0.608
Aliphatic Index 56.67
Half Life
Extinction Coefficient cystines 3355
Absorbance 280nm 0.822
Polar residues 23
Literature Information
Literature 1
Title Small cationic protein from a marine turtle has beta-defensin-like fold and antibacterial and antiviral activity
Pubmed ID 16700051
Reference Proteins, 64(2), 524–531.
Author Chattopadhyay, S., Sinha, N. K., Banerjee, S., Roy, D., Chattopadhyay, D., & Roy, S. (2006).