General Information


DRAVP ID  DRAVPe02307

Peptide Name   Tat-Ebo

Sequence  YGRKKRRQRRRGSGIEPHDWTKNITDKIDQIIHDFVDK

Sequence Length  38

UniProt ID  No entry found

Taxon ID  None

Source  Synthetic construct

Validation   Experimentally Validated



Origin Information


Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available



Activity Information


Target Organism  EBOV

Assay  Not Available

Activity 

  • [Ref:23962564]EBOV:IC50=75 microM

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

  • [Ref:23962564]Low cytotoxicity (cytotoxicity assays indicated that Tat-Ebo was well tolerated by Vero cells at concentrations up to 75 microM).

Binding Target  Viral membrane.

Mechanism   Tat-Ebo, a peptide combining HIV-1 Tat Arg-rich sequence with Ebola virus GP2 residues 610 - 633, combats Ebola virus within cells. It impedes viral membrane fusion by binding to a GP2 fusion intermediate, particularly targeting the extended conformation during fusion. Tat-Ebo enhances its antiviral efficacy by promoting internalization into cells and accumulating in endosomes. Its mode of action involves sequestering the extended intermediate, crucial for its effectiveness. Tat-Ebo's specificity lies in inhibiting filovirus GP proteins, including various strains, through sequestration. Demonstrating broad-spectrum inhibition, it effectively hampers infection mediated by diverse Ebola virus strains.



Structure Information


PDB ID  None

Predicted Structure Download  No predicted structure available

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C203H329N69O58

Absent amino acids  ACLMOU

Common amino acids  R

Mass  4664.27

Pl  10.27

Basic residues  11

Acidic residues  6

Hydrophobic residues  8

Net charge  5

Boman Index  4.38

Hydrophobicity  -1.634

Aliphatic Index  58.95

Half Life 

  •     Mammalian:2.8hours
  •     Yeast:10min
  •     E.coli:2min

Extinction Coefficient cystines  6990

Absorbance 280nm  1.499

Polar residues  26



Literature Information


Literature 1

Title   Inhibition of Ebola virus entry by a C-peptide targeted to endosomes;

Pubmed ID   21454542

Reference   J Biol Chem. 2011;286(18):15854-61;

Author   Miller EH, Harrison JS, Radoshitzky SR;

DOI   10.1074/jbc.M110.207084;

Literature 2

Title   C-peptide inhibitors of Ebola virus glycoprotein-mediated cell entry: effects of conjugation to cholesterol and side chain-side chain crosslinking

Pubmed ID   23962564

Reference   Bioorg Med Chem Lett. 2013;23(19):5356-60.

Author   Higgins CD, Koellhoffer JF, Chandran K,

DOI   10.1016/j.bmcl.2013.07.056