General Information
DRAVP ID DRAVPe02307
Peptide Name Tat-Ebo
Sequence YGRKKRRQRRRGSGIEPHDWTKNITDKIDQIIHDFVDK
Sequence Length 38
UniProt ID No entry found
Taxon ID None
Source Synthetic construct
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism EBOV
Assay Not Available
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target Viral membrane.
Mechanism Tat-Ebo, a peptide combining HIV-1 Tat Arg-rich sequence with Ebola virus GP2 residues 610 - 633, combats Ebola virus within cells. It impedes viral membrane fusion by binding to a GP2 fusion intermediate, particularly targeting the extended conformation during fusion. Tat-Ebo enhances its antiviral efficacy by promoting internalization into cells and accumulating in endosomes. Its mode of action involves sequestering the extended intermediate, crucial for its effectiveness. Tat-Ebo's specificity lies in inhibiting filovirus GP proteins, including various strains, through sequestration. Demonstrating broad-spectrum inhibition, it effectively hampers infection mediated by diverse Ebola virus strains.
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C203H329N69O58
Absent amino acids ACLMOU
Common amino acids R
Mass 4664.27
Pl 10.27
Basic residues 11
Acidic residues 6
Hydrophobic residues 8
Net charge 5
Boman Index 4.38
Hydrophobicity -1.634
Aliphatic Index 58.95
Half Life
Extinction Coefficient cystines 6990
Absorbance 280nm 1.499
Polar residues 26
Literature Information
Literature 1
Title Inhibition of Ebola virus entry by a C-peptide targeted to endosomes;
Pubmed ID 21454542
Reference J Biol Chem. 2011;286(18):15854-61;
Author Miller EH, Harrison JS, Radoshitzky SR;
Literature 2
Title C-peptide inhibitors of Ebola virus glycoprotein-mediated cell entry: effects of conjugation to cholesterol and side chain-side chain crosslinking
Pubmed ID 23962564
Reference Bioorg Med Chem Lett. 2013;23(19):5356-60.
Author Higgins CD, Koellhoffer JF, Chandran K,