DRAVP ID  DRAVPe02314

Peptide Name   EBOV-3

Sequence  IEPHDWTKNITDKIDQIIHDFVDKTLPDQG

Sequence Length  30

UniProt ID  No entry found

Taxon ID  None

Source  Cholesterol-conjugated synthetic peptide

Validation   Experimentally Validated

Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available

Target Organism  EBOV

Assay  Not Available

Activity 

• [Ref:31473342]EBOV:EC50 = 12.89 plusminus 1.59 microM, 11.94 plusminus 2.59 microM

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

• [Ref:31473342]EBOV-3 show cytotoxicity (CC50) at greater than 30 microM.

Binding Target  Glycoprotein.

Mechanism  EBOV-3 is an elongated peptide with five residues downstream of the helical domain. This modification likely contributes to the peptide's potency in inhibiting EBOV infection. By targeting specific regions of the EBOV glycoprotein, EBOV-3 interferes with viral entry and replication processes, ultimately inhibiting the virus's ability to infect host cells

PDB ID  None

Predicted Structure Download 

Linear/Cyclic  Cyclic

N-terminal Modification  cholesterylation

C-terminal Modification  PEG4

Other Modification  In the peptide sequence, the cysteine residue at position 31 is modified with a PEG4-cholesterol (PEG4-Chol) moiety.

Stereochemistry  L

Literature 1

Title   Cholesterol-conjugated stapled peptides inhibit Ebola and Marburg viruses in vitro and in vivo

Pubmed ID   31473342

Reference   Antiviral Res. 2019;171:104592. 

Author   Pessi A, Bixler SL, Soloveva V, et al

DOI   10.1016/j.antiviral.2019.104592