DRAVP ID  DRAVPe02318

Peptide Name   EBOV-7

Sequence  IEPHDWTKNIKDKIDKIIHDFVDKTLPDQG

Sequence Length  30

UniProt ID  No entry found

Taxon ID  None

Source  Cholesterol-conjugated synthetic peptide

Validation   Experimentally Validated

Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available

Target Organism  EBOV

Assay  Not Available

Activity 

• [Ref:31473342]EBOV:EC50=1.90 plusminus 0.28;EC90=9.44 microM.EBOV-GP EC50=0.60 plusminus 0.20 microM;EBOV-GP EC90=6.15 microM.ma-EBOV EC50=0.50 plusminus 0.09 microM;ma-EBOV EC90=3.45 microM.GP =>GlycoProtein;ma =>Mouse-Adapted

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

• [Ref:31473342]EBOV-7 show cytotoxicity (CC50) at greater than 30 microM.EBOV-5 show cytotoxicity (CC50) at >= 25 microM (when tested for EBOV-GP).EBOV-5 show cytotoxicity (CC50) at >= 42.6 microM (whe

Binding Target  Glycoprotein.

Mechanism  EBOV-7 works against Ebola virus by targeting its entry and replication processes. It likely prevents the virus from binding to host cell receptors or fusing with cellular membranes, thus inhibiting viral entry. The peptide stabilizes an alpha-helical structure, enhancing its ability to interact with viral components critical for these processes. With a potency of 0.5 microM, EBOV-7 effectively disrupts the viral life cycle. In vivo studies in mice have shown that EBOV-7 has robust antiviral activity against Ebola virus, further confirming its efficacy. Overall, EBOV-7 interferes with viral entry and stabilizes essential structures, making it a strong candidate for therapeutic use against Ebola.

PDB ID  None

Predicted Structure Download 

Linear/Cyclic  Cyclic

N-terminal Modification  cholesterylation

C-terminal Modification  PEG12

Other Modification  In the peptide sequence, the cysteine residue at position 31 is modified with a PEG4-cholesterol (PEG4-Chol) moiety

Stereochemistry  L

Literature 1

Title   Cholesterol-conjugated stapled peptides inhibit Ebola and Marburg viruses in vitro and in vivo

Pubmed ID   31473342

Reference   Antiviral Res. 2019;171:104592. 

Author   Pessi A, Bixler SL, Soloveva V, et al

DOI   10.1016/j.antiviral.2019.104592