General Information
DRAVP ID DRAVPe02318
Peptide Name EBOV-7
Sequence IEPHDWTKNIKDKIDKIIHDFVDKTLPDQG
Sequence Length 30
UniProt ID No entry found
Taxon ID None
Source Cholesterol-conjugated synthetic peptide
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism EBOV
Assay Not Available
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target Glycoprotein.
Mechanism EBOV-7 works against Ebola virus by targeting its entry and replication processes. It likely prevents the virus from binding to host cell receptors or fusing with cellular membranes, thus inhibiting viral entry. The peptide stabilizes an alpha-helical structure, enhancing its ability to interact with viral components critical for these processes. With a potency of 0.5 microM, EBOV-7 effectively disrupts the viral life cycle. In vivo studies in mice have shown that EBOV-7 has robust antiviral activity against Ebola virus, further confirming its efficacy. Overall, EBOV-7 interferes with viral entry and stabilizes essential structures, making it a strong candidate for therapeutic use against Ebola.
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Cyclic
N-terminal Modification cholesterylation
C-terminal Modification PEG12
Other Modification In the peptide sequence, the cysteine residue at position 31 is modified with a PEG4-cholesterol (PEG4-Chol) moiety
Stereochemistry L
Physicochemical Information
Formula C161H252N42O49
Absent amino acids ACMORSUY
Common amino acids D
Mass 3560.02
Pl 5.37
Basic residues 5
Acidic residues 7
Hydrophobic residues 9
Net charge -2
Boman Index 2.45
Hydrophobicity -1
Aliphatic Index 87.67
Half Life
Extinction Coefficient cystines 5500
Absorbance 280nm 1.545
Polar residues 18
Literature Information
Literature 1
Title Cholesterol-conjugated stapled peptides inhibit Ebola and Marburg viruses in vitro and in vivo
Pubmed ID 31473342
Reference Antiviral Res. 2019;171:104592.
Author Pessi A, Bixler SL, Soloveva V, et al