To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe02319
Peptide Name EBOV-8
Sequence IGIEDLSKNIKDKIDKIIHDFVDKTLPDQG
Sequence Length 30
UniProt ID No entry found
Taxon ID None
Source Cholesterol-conjugated synthetic peptide
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism EBOV
Assay N/A
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target Glycoprotein.
Mechanism Exact MoA explicitly not available (EBOV-8 likely inhibits Ebola virus by targeting viral entry and fusion processes. It may interfere with viral glycoproteins, preventing the virus from attaching to and entering host cells. Additionally, EBOV-8 could disrupt the fusion between the viral envelope and host cell membrane, blocking the release of viral genetic material. By targeting these critical steps, the peptide effectively halts infection and viral replication. The specific antiviral mechanisms of EBOV-8 involve interactions with viral proteins essential for these processes. Detailed studies and assays in the full research paper would provide further insights into these mechanisms.).
Structure Information
PDB ID None
Linear/Cyclic Cyclic
N-terminal Modification cholesterylation
C-terminal Modification PEG12
Other Modification In the peptide sequence, the cysteine residue at position 31 is modified with a PEG12-cholesterol (PEG12-Chol) moiety
Stereochemistry L
Physicochemical Information
Formula C152H251N39O49
Absent amino acids ACMORUWY
Common amino acids DI
Mass 3408.9
Pl 4.89
Basic residues 5
Acidic residues 7
Hydrophobic residues 10
Net charge -2
Boman Index 2.04
Hydrophobicity -0.55
Aliphatic Index 113.67
Half Life
Extinction Coefficient cystines None
Absorbance 280nm None
Polar residues 17
Literature Information
Literature 1
Title Cholesterol-conjugated stapled peptides inhibit Ebola and Marburg viruses in vitro and in vivo
Pubmed ID 31473342
Reference Antiviral Res. 2019;171:104592.
Author Pessi A, Bixler SL, Soloveva V, et al
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.