To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe02661
Peptide Name HBD2
Sequence DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKP
Sequence Length 37
UniProt ID Q9TT12
Taxon ID None
Source Human alpha defensin
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism BKV
Assay Flow cytometry
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target Membrane
Mechanism HBD2 inhibit BKV infection by targeting an early event in the viral lifecycle
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula H63C110N23O20S1
Absent amino acids HMW
Common amino acids CPTKG
Mass 1560.7777
Pl 10.8352174758911
Basic residues 3
Acidic residues 1
Hydrophobic residues 5
Net charge 1.79597634799492
Boman Index 0.865
Hydrophobicity -0.633333333333333
Aliphatic Index 65.33
Half Life
Extinction Coefficient cystines 0
Absorbance 280nm 0
Polar residues 10
Literature Information
Literature 1
Title Human alpha-defensins inhibit BK virus infection by aggregating virions and blocking binding to host cells.
Pubmed ID 18782756
Reference J Biol Chem. 2008
Author Dugan AS, Maginnis MS, Jordan JA, Gasparovic ML, Manley K, Page R, Williams G, Porter E, O'Hara BA, Atwood WJ.
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.