To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe02668
Peptide Name AvBD3
Sequence TATQCRIRGGFCRVGSCRFPHIAIGKCATFISCCGRAYEVDALNSVRTSPWLLAPGNNPH
Sequence Length 60
UniProt ID Q9DG58
Taxon ID None
Source Duck beta defensin
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism DHV
Assay Neutralization assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target Membrane
Mechanism Not Available
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula H98C177N29O20S0
Absent amino acids HMW
Common amino acids CATR
Mass 2099.65139999999
Pl 11.9999677658081
Basic residues 5
Acidic residues 0
Hydrophobic residues 13
Net charge 4.75708461139229
Boman Index 0.919
Hydrophobicity 0.715
Aliphatic Index 156.5
Half Life
Extinction Coefficient cystines 0
Absorbance 280nm 0
Polar residues 7
Literature Information
Literature 1
Title Identification, expression and activity analyses of five novel duck beta-defensins.
Pubmed ID 23112840
Reference PLoS One. 2012
Author Ma D, Zhang K, Zhang M, Xin S, Liu X, Han Z, Shao Y, Liu S.
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.