To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe02682
Peptide Name S25
Sequence WCNWHNIDPWIQLMNRTQADLAEGPPVKEC
Sequence Length 30
UniProt ID P21530
Taxon ID None
Source CSFV envelope protein (E2)
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism CSFV
Assay Plaque assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target Membrane
Mechanism Inhibit CSFV entering
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula H143C222N39O51S0
Absent amino acids HMF
Common amino acids PWN
Mass 3324.562
Pl 4.05002841949462
Basic residues 1
Acidic residues 5
Hydrophobic residues 13
Net charge -4.22399819814388
Boman Index 0.851
Hydrophobicity -0.1
Aliphatic Index 104
Half Life
Extinction Coefficient cystines 0
Absorbance 280nm 0
Polar residues 17
Literature Information
Literature 1
Title Identification of host cell binding peptide from an overlapping peptide library for inhibition of classical swine fever virus infection.
Pubmed ID 21400206
Reference Virus Genes. 2011
Author Li X, Wang L, Zhao D, Zhang G, Luo J, Deng R, Yang Y.
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.