To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe02686
Peptide Name sHR1
Sequence AYRFNGIQVTQNVLYENQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLIT
Sequence Length 96
UniProt ID P59594
Taxon ID 694009
Source SARS-CoV spike protein
Validation Experimentally Validated
Origin Information
Gene Name/ID S
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID AY274119.3
Molecular Type Genomic RNA
Chromosomal Position Chromosome:21,492 - 25,259
Activity Information
Target Organism SARS-CoV
Assay Immunofluorescence
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target Membrane
Mechanism Inhibit Fusion
Structure Information
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula H174C293N48O55S2
Absent amino acids HMW
Common amino acids TLVIAQ
Mass 4022.64549999999
Pl 8.90368022918701
Basic residues 7
Acidic residues 5
Hydrophobic residues 13
Net charge 1.7528815238976
Boman Index 1.232
Hydrophobicity -0.851428571428571
Aliphatic Index 89.14
Half Life
Extinction Coefficient cystines 1490
Absorbance 280nm 0.370403009661179
Polar residues 22
Literature Information
Literature 1
Title Severe acute respiratory syndrome coronavirus (SARS-CoV) infection inhibition using spike protein heptad repeat-derived peptides.
Pubmed ID 15150417
Reference Proc Natl Acad Sci U S A. 2004
Author Bosch BJ, Martina BE, Van Der Zee R, Lepault J, Haijema BJ, Versluis C, Heck AJ, De Groot R, Osterhaus AD, Rottier PJ.
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.