To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe02693
Peptide Name NiV FC2
Sequence KVDISSQISSMNQSLQQSKDYIKEAQRLLDTVNPSL
Sequence Length 37
UniProt ID Q9IH63
Taxon ID None
Source NiV fusion glycoprotein
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism HeV,NiV
Assay Immunofluorescence
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target Fusion
Mechanism Not Available
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula H88C138N23O20S0
Absent amino acids CYOU
Common amino acids QKSL
Mass 1857.2022
Pl 9.99396953582763
Basic residues 2
Acidic residues 0
Hydrophobic residues 8
Net charge 1.73198038805714
Boman Index 0.683
Hydrophobicity 0.505555555555555
Aliphatic Index 113.33
Half Life
Extinction Coefficient cystines 1490
Absorbance 280nm 0.802282056310293
Polar residues 10
Literature Information
Literature 1
Title Inhibition of Henipavirus fusion and infection by heptad-derived peptides of the Nipah virus fusion glycoprotein.
Pubmed ID 16026621
Reference Virol J. 2005
Author Bossart KN, Mungall BA, Crameri G, Wang LF, Eaton BT, Broder CC.
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.