DRAVP ID DRAVPa0002
Peptide Name Sequence 2 from Patent US 20190367567
Sequence SIFSLFKMGAKALGKTLLKQAGKAGAEYAACKATNQC
Sequence Length 37
Source Synthetic construct
Target Organism H1N1
Patent Type Patent Application
Publication Date 2019-12-05
Patent No US 2019/0367567 A1
Family Info WO 2018/102753 A1, EP 3548056 A1, US 2019/0367567 A1, EP 3548056 A4
Patent Title Peptides and Uses for Managing Viral Infections
Comment The peptide is useful for the prevention or treatment of viral infections such as influenza infections and exhibits no toxicity to human red blood cells.
Abstract It has been discovered that certain peptides are useful for managing certain viral infections. Thus, this disclosure relates to the use of peptides reported herein for the prevention or treatment of viral infections such as influenza infections. In certain embodiments, this disclosure relates to peptides, variants, or derivatives having sequences disclosed herein and pharmaceutical compositions comprising the same.