Patent Information


DRAVP ID  DRAVPa0002

Peptide Name   Sequence 2 from Patent US 20190367567

Sequence  SIFSLFKMGAKALGKTLLKQAGKAGAEYAACKATNQC

Sequence Length  37

Source  Synthetic construct

Target Organism  H1N1

Patent Type  Patent Application

Publication Date  2019-12-05

Patent No  US 2019/0367567 A1

Family Info  WO 2018/102753 A1, EP 3548056 A1, US 2019/0367567 A1, EP 3548056 A4

Patent Title  Peptides and Uses for Managing Viral Infections

Comment  The peptide is useful for the prevention or treatment of viral infections such as influenza infections and exhibits no toxicity to human red blood cells.

Abstract  It has been discovered that certain peptides are useful for managing certain viral infections. Thus, this disclosure relates to the use of peptides reported herein for the prevention or treatment of viral infections such as influenza infections. In certain embodiments, this disclosure relates to peptides, variants, or derivatives having sequences disclosed herein and pharmaceutical compositions comprising the same.