Patent Information


DRAVP ID  DRAVPa0051

Peptide Name   Sequence 15 from Patent US 2009/0264344 A1

Sequence  MRTFALLTAMLLLVALHAQAEARQARADEAAAQQQPGTDDQGMAHSFTWPENAALPLSESAKGLRCICTRGFCRLL

Sequence Length  76

Source  Macaca mulatta

Target Organism  HIV-1,HSV-1,HSV-2

Patent Type  Patent Application

Publication Date  2009-10-22

Patent No  US 2009/0264344 A1

Family Info  US 2005/0272645 A1, WO 2006/052637 A1, US 7314858 B2, US 2009/0264344 A1, US 7718610 B2

Patent Title  Retrocyclins: Antiviral and Antimicrobial Peptides

Comment  The peptide has potent activity against viruses, e.g. enveloped viruses such as retroviruses.It is nonhemolytic and generally exhibits little or no in vitro cytotoxicity.

Abstract  Retrocyclin peptides are small antimicrobial agents with potent activity against bacteria and viruses. The peptides are nonhemolytic, and exhibit minimal in vitro cytotoxicity. A pharmaceutical composition comprising retrocyclin as an active agent is administered therapeutically to a patient suffering from a bacterial and/or viral infection, or to an individual facing exposure to a bacterial and/or viral infection, especially one caused by the HIV-1 retrovirus or other sexually-transmitted pathogens.