DRAVP ID DRAVPa0051
Peptide Name Sequence 15 from Patent US 2009/0264344 A1
Sequence MRTFALLTAMLLLVALHAQAEARQARADEAAAQQQPGTDDQGMAHSFTWPENAALPLSESAKGLRCICTRGFCRLL
Sequence Length 76
Source Macaca mulatta
Target Organism HIV-1,HSV-1,HSV-2
Patent Type Patent Application
Publication Date 2009-10-22
Patent No US 2009/0264344 A1
Family Info US 2005/0272645 A1, WO 2006/052637 A1, US 7314858 B2, US 2009/0264344 A1, US 7718610 B2
Patent Title Retrocyclins: Antiviral and Antimicrobial Peptides
Comment The peptide has potent activity against viruses, e.g. enveloped viruses such as retroviruses.It is nonhemolytic and generally exhibits little or no in vitro cytotoxicity.
Abstract Retrocyclin peptides are small antimicrobial agents with potent activity against bacteria and viruses. The peptides are nonhemolytic, and exhibit minimal in vitro cytotoxicity. A pharmaceutical composition comprising retrocyclin as an active agent is administered therapeutically to a patient suffering from a bacterial and/or viral infection, or to an individual facing exposure to a bacterial and/or viral infection, especially one caused by the HIV-1 retrovirus or other sexually-transmitted pathogens.