DRAVP ID DRAVPa0169
Peptide Name Sequence 3 from Patent US 8080633
Sequence TRPNNNTRKSIIGPGRAFYTTGQIIGDIRQAH
Sequence Length 32
Source Human immunodeficiency virus(HIV sub B)
Target Organism HIV
Patent Type Granted Patent
Publication Date 2011-12-20
Patent No US 8080633 B2
Family Info WO 2003/091275 A2, AU 2003/241103 A8, AU 2003/241103 A1, US 2004/0116653 A1, US 8030444 B2, US 2009/0170764 A1, US 7553926 B2, US 2009/0088381 A1
Patent Title Antiviral compositions comprising a multiple branched peptide construct containing human CD38 leukocyte surface antigen polypeptides
Comment
Abstract Peptides representing sequences from region 45-74 of the human CD38 leukocyte surface antigen (SEQ ID NO:1) are provided which may be used to inhibit or prevent transmission or replication of the HIV virus. The peptides have from 13 to 30 amino acids and include the amino acid sequence GPGTTK (SEQ ID NO:18) for topical application to inhibit or prevent transmission of the HIV virus.