Patent Information


DRAVP ID  DRAVPa0185

Peptide Name   Sequence 19 from Patent US 8080633

Sequence  RWRQQWSGPGTTKRFPETVLARCVKYTEIH

Sequence Length  30

Source  Homo sapiens

Target Organism  HIV

Patent Type  Granted Patent

Publication Date  2011-12-20

Patent No  US 8080633 B2

Family Info  WO 2003/091275 A2, AU 2003/241103 A8, AU 2003/241103 A1, US 2004/0116653 A1, US 8030444 B2, US 2009/0170764 A1, US 7553926 B2, US 2009/0088381 A1

Patent Title  Antiviral compositions comprising a multiple branched peptide construct containing human CD38 leukocyte surface antigen polypeptides

Comment 

Abstract  Peptides representing sequences from region 45-74 of the human CD38 leukocyte surface antigen (SEQ ID NO:1) are provided which may be used to inhibit or prevent transmission or replication of the HIV virus. The peptides have from 13 to 30 amino acids and include the amino acid sequence GPGTTK (SEQ ID NO:18) for topical application to inhibit or prevent transmission of the HIV virus.