DRAVP ID DRAVPa0233
Peptide Name Sequence 54 from Patent US 7811577 B2
Sequence IKKEIEAIKKEQEAIKKKIEAIEKLLQLTVWGIKQLQARILAVERYLK
Sequence Length 48
Source Synthetic construct
Target Organism HIV
Patent Type Granted Patent
Publication Date 2010-12-12
Patent No US 7811577 B2
Family Info WO 2005/118886 A2, AU 2005/250430 A1, CA 2567030 A1, WO 2005/118886 A3, EP 1755667 A2, CN 1968710 A, US 2007/0224212 A1, JP 2008501028 A, EP 1755667 A4, US 7811577 B2, EP 2354153 A2, AU 2005/250430 B2
Patent Title Covalently stabilized chimeric coiled-coil HIV gp41 N-peptides with improved antiviral activity
Comment The peptide was modified with acetyl N-terminus and amide C-terminus.
Abstract Methods of covalently-stabilizing alpha-helical, chimeric peptides constrained within a homotrimeric or heterotrimeric coiled-coil structure are disclosed. The coiled-coil structures made by the methods disclosed within this specification mimic all or a portion of the internal, trimeric coiled-coil motif contained within the fusogenic conformation of an enveloped virus membrane-fusion protein, particularly the internal coiled-coil domain of the HIV gp41 ectodomain. The HIV-derived, chimeric peptides disclosed comprise a non-HIV, soluble, trimeric form of a coiled-coil fused in helical phase to all or a portion of the N-helix of HIV gp41 and are covalently-stabilized in a homotrimeric or heterotrimeric coiled-coil structure through the formation of disulfide or chemoselective bonds between said peptides. The covalently-stabilized, HIV-derived, homotrimeric or heterotrimeric coiled-coil structures made by the methods disclosed herein represent a close mimetic of a HIV gp41 fusion intermediate and are potent inhibitors of HIV infectivity. These HIV-derived chimeric peptides may provide for therapeutic treatment against HIV infection by inhibiting the virus-host cell membrane fusion process.